Property Summary

NCBI Gene PubMed Count 9
Grant Count 60
R01 Count 11
Funding $14,279,595.21
PubMed Score 78.45
PubTator Score 5.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.100 0.000
malignant mesothelioma -3.900 0.000
ependymoma -1.800 0.014
oligodendroglioma -1.100 0.035
psoriasis 1.800 0.000
glioblastoma 2.000 0.005
osteosarcoma 1.610 0.000
intraductal papillary-mucinous adenoma (... 1.900 0.004
intraductal papillary-mucinous carcinoma... 1.800 0.010
intraductal papillary-mucinous neoplasm ... 2.400 0.010
lung cancer 1.200 0.047
pancreatic cancer 1.200 0.000
fibroadenoma 1.100 0.007
Breast cancer 2.900 0.033
pediatric high grade glioma 1.400 0.016
group 4 medulloblastoma -1.200 0.036
subependymal giant cell astrocytoma -1.079 0.038
spina bifida -1.782 0.036
ductal carcinoma in situ 1.700 0.003
invasive ductal carcinoma 1.500 0.010
ovarian cancer 1.700 0.000
pituitary cancer -1.400 0.006

Gene RIF (2)

PMID Text
25301234 MREG-dependent processing links both autophagic and phagocytic processes in LC3-associated phagocytosis. MREG participates in coordinating the association of phagosomes with LC3 for content degradation with the MREG loss leading to phagosome accumulation.
20463177 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTL      1 - 70
YNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTR     71 - 140
KAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLP    141 - 210
FPSP                                                                      211 - 214
//

Text Mined References (13)

PMID Year Title
25301234 2015 The Contribution of Melanoregulin to Microtubule-Associated Protein 1 Light Chain 3 (LC3) Associated Phagocytosis in Retinal Pigment Epithelium.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
22275436 2012 Melanoregulin regulates retrograde melanosome transport through interaction with the RILP-p150Glued complex in melanocytes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20463177 2010 Multistudy fine mapping of chromosome 2q identifies XRCC5 as a chronic obstructive pulmonary disease susceptibility gene.
19240024 2009 Melanoregulin (MREG) modulates lysosome function in pigment epithelial cells.
17260955 2007 The tetraspanin protein peripherin-2 forms a complex with melanoregulin, a putative membrane fusion regulator.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15550542 2004 dsu functions in a MYO5A-independent pathway to suppress the coat color of dilute mice.
More...