Property Summary

NCBI Gene PubMed Count 10
PubMed Score 82.95
PubTator Score 5.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Breast cancer 2.900 3.3e-02
ductal carcinoma in situ 1.700 2.7e-03
ependymoma -1.800 1.4e-02
fibroadenoma 1.100 7.2e-03
gastric cancer 1.100 1.3e-04
glioblastoma 2.000 5.1e-03
group 4 medulloblastoma -1.200 3.6e-02
intraductal papillary-mucinous adenoma (... 1.900 4.1e-03
intraductal papillary-mucinous carcinoma... 1.800 1.0e-02
intraductal papillary-mucinous neoplasm ... 2.400 1.0e-02
invasive ductal carcinoma 1.500 1.0e-02
lung cancer 1.200 4.7e-02
malignant mesothelioma -3.900 2.4e-07
oligodendroglioma -1.100 3.5e-02
osteosarcoma 1.610 3.2e-04
ovarian cancer 1.100 7.9e-03
pancreatic cancer 1.200 7.3e-06
pediatric high grade glioma 1.400 1.6e-02
pituitary cancer -1.400 5.8e-03
psoriasis 1.300 1.2e-08
spina bifida -1.782 3.6e-02
subependymal giant cell astrocytoma -1.079 3.8e-02

Gene RIF (3)

AA Sequence

MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTL      1 - 70
YNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTR     71 - 140
KAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLP    141 - 210
FPSP                                                                      211 - 214
//

Text Mined References (14)

PMID Year Title