Property Summary

NCBI Gene PubMed Count 9
PubMed Score 78.45
PubTator Score 5.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 3.00705716032076E-14
malignant mesothelioma 3163 2.43814044262394E-7
pancreatic cancer 2300 7.32615915180684E-6
ovarian cancer 8492 1.07139425408227E-4
gastric cancer 436 1.31399570359966E-4
osteosarcoma 7933 3.15797519363784E-4
ductal carcinoma in situ 1745 0.0026849336979673
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00412288527426395
glioblastoma 5572 0.00509607784725147
pituitary cancer 1972 0.00583397622261349
fibroadenoma 557 0.00719543705780777
invasive ductal carcinoma 2950 0.0102688225014737
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0103793835137587
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0104490887927004
ependymoma 2514 0.0139751797735838
pediatric high grade glioma 2712 0.015646934861764
Breast cancer 3099 0.0327437730050126
oligodendroglioma 2849 0.0346107873169969
group 4 medulloblastoma 1875 0.0356403223224633
spina bifida 1064 0.035817889435841
subependymal giant cell astrocytoma 2287 0.0382545716397692
lung cancer 4473 0.0470428236577934
Disease Target Count Z-score Confidence
substance-related disorder 105 0.0 2.0
Disease Target Count Z-score Confidence
Methemoglobinemia 17 3.745 1.9

Expression

  Differential Expression (22)

Disease log2 FC p
gastric cancer 1.100 0.000
malignant mesothelioma -3.900 0.000
ependymoma -1.800 0.014
oligodendroglioma -1.100 0.035
psoriasis 1.800 0.000
glioblastoma 2.000 0.005
osteosarcoma 1.610 0.000
intraductal papillary-mucinous adenoma (... 1.900 0.004
intraductal papillary-mucinous carcinoma... 1.800 0.010
intraductal papillary-mucinous neoplasm ... 2.400 0.010
lung cancer 1.200 0.047
pancreatic cancer 1.200 0.000
fibroadenoma 1.100 0.007
Breast cancer 2.900 0.033
pediatric high grade glioma 1.400 0.016
group 4 medulloblastoma -1.200 0.036
subependymal giant cell astrocytoma -1.079 0.038
spina bifida -1.782 0.036
ductal carcinoma in situ 1.700 0.003
invasive ductal carcinoma 1.500 0.010
ovarian cancer 1.700 0.000
pituitary cancer -1.400 0.006

Synonym

Accession Q8N565 Q53R89 Q53TC1 Q5XKB6 Q9NWC9 Q9P1S1
Symbols DSU
WDT2

Gene

  Ortholog (13)

Pathway (1)

Gene RIF (2)

PMID Text
25301234 MREG-dependent processing links both autophagic and phagocytic processes in LC3-associated phagocytosis. MREG participates in coordinating the association of phagosomes with LC3 for content degradation with the MREG loss leading to phagosome accumulation.
20463177 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTL      1 - 70
YNLIVIRNQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSVTKLSTISDSKNTR     71 - 140
KAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALDAAEEFFKLARRTYPKKPGVPCLADGQKELHYLP    141 - 210
FPSP                                                                      211 - 214
//

Text Mined References (13)

PMID Year Title
25301234 2015 The Contribution of Melanoregulin to Microtubule-Associated Protein 1 Light Chain 3 (LC3) Associated Phagocytosis in Retinal Pigment Epithelium.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
22275436 2012 Melanoregulin regulates retrograde melanosome transport through interaction with the RILP-p150Glued complex in melanocytes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20463177 2010 Multistudy fine mapping of chromosome 2q identifies XRCC5 as a chronic obstructive pulmonary disease susceptibility gene.
19240024 2009 Melanoregulin (MREG) modulates lysosome function in pigment epithelial cells.
17260955 2007 The tetraspanin protein peripherin-2 forms a complex with melanoregulin, a putative membrane fusion regulator.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15550542 2004 dsu functions in a MYO5A-independent pathway to suppress the coat color of dilute mice.
More...