Property Summary

NCBI Gene PubMed Count 20
PubMed Score 69.99
PubTator Score 32.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.2e-04
group 4 medulloblastoma 1.600 2.1e-04
ovarian cancer -1.700 1.7e-06

Gene RIF (5)

AA Sequence

MEELIVELRLFLELLDHEYLTSTVREKKAVITNILLRIQSSKGFDVKDHAQKQETANSLPAPPQMPLPEI      1 - 70
PQPWLPPDSGPPPLPTSSLPEGYYEEAVPLSPGKAPEYITSNYDSDAMSSSYESYDEEEEDGKGKKTRHQ     71 - 140
WPSEEASMDLVKDAKICAFLLRKKRFGQWTKLLCVIKDTKLLCYKSSKDQQPQMELPLQGCNITYIPKDS    141 - 210
KKKKHELKITQQGTDPLVLAVQSKEQAEQWLKVIKEAYSGCSGPVDSECPPPPSSPVHKAELEKKLSSER    211 - 280
PSSDGEGVVENGITTCNGKEQVKRKKSSKSEAKGTVSKVTGKKITKIISLGKKKPSTDEQTSSAEEDVPT    281 - 350
CGYLNVLSNSRWRERWCRVKDNKLIFHKDRTDLKTHIVSIPLRGCEVIPGLDSKHPLTFRLLRNGQEVAV    351 - 420
LEASSSEDMGRWIGILLAETGSSTDPEALHYDYIDVEMSASVIQTAKQTFCFMNRRVISANPYLGGTSNG    421 - 490
YAHPSGTALHYDDVPCINGSLKGKKPPVASNGVTGKGKTLSSQPKKADPAAVVKRTGSNAAQYKYGKNRV    491 - 560
EADAKRLQTKEEELLKRKEALRNRLAQLRKERKDLRAAIEVNAGRKPQAILEEKLKQLEEECRQKEAERV    561 - 630
SLELELTEVKESLKKALAGGVTLGLAIEPKSGTSSPQSPVFRHRTLENSPISSCDTSDTEGPVPVNSAAV    631 - 700
LKKSQAAPGSSPCRGHVLRKAKEWELKNGT                                            701 - 730
//

Text Mined References (32)

PMID Year Title