Property Summary

NCBI Gene PubMed Count 9
Grant Count 6
R01 Count 6
Funding $668,239.5
PubMed Score 23.86
PubTator Score 22.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.700 0.000
osteosarcoma 1.567 0.000
primary pancreatic ductal adenocarcinoma 1.086 0.009
tuberculosis and treatment for 3 months -1.100 0.001
Breast cancer 2.900 0.023
subependymal giant cell astrocytoma 1.498 0.005
ovarian cancer 1.600 0.000

Gene RIF (4)

PMID Text
25909288 Propose that OGFOD1 is required for breast cancer cell proliferation and is associated with poor prognosis in breast cancer.
24550447 OGFOD1 catalyzes prolyl hydroxylation of RPS23 and is involved in translation control and stress granule formation.
20579638 OGFOD1 plays an important role in ischemic cell survival and an OGFOD1 iron binding residue is required for ATPAF1 gene expression.
20154146 Data suggest that OGFOD1 plays important proapoptotic roles in the regulation of translation and HRI-mediated phosphorylation of eIF2alpha in cells subjected to arsenite-induced stress.

AA Sequence

MNGKRPAEPGPARVGKKGKKEVMAEFSDAVTEETLKKQVAEAWSRRTPFSHEVIVMDMDPFLHCVIPNFI      1 - 70
QSQDFLEGLQKELMNLDFHEKYNDLYKFQQSDDLKKRREPHISTLRKILFEDFRSWLSDISKIDLESTID     71 - 140
MSCAKYEFTDALLCHDDELEGRRIAFILYLVPPWDRSMGGTLDLYSIDEHFQPKQIVKSLIPSWNKLVFF    141 - 210
EVSPVSFHQVSEVLSEEKSRLSISGWFHGPSLTRPPNYFEPPIPRSPHIPQDHEILYDWINPTYLDMDYQ    211 - 280
VQIQEEFEESSEILLKEFLKPEKFTKVCEALEHGHVEWSSRGPPNKRFYEKAEESKLPEILKECMKLFRS    281 - 350
EALFLLLSNFTGLKLHFLAPSEEDEMNDKKEAETTDITEEGTSHSPPEPENNQMAISNNSQQSNEQTDPE    351 - 420
PEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEEL    421 - 490
LTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSFIYYE                      491 - 542
//

Text Mined References (13)

PMID Year Title
25909288 2015 OGFOD1 is required for breast cancer cell proliferation and is associated with poor prognosis in breast cancer.
24550462 2014 Hydroxylation of the eukaryotic ribosomal decoding center affects translational accuracy.
24550447 2014 OGFOD1 catalyzes prolyl hydroxylation of RPS23 and is involved in translation control and stress granule formation.
22002106 2012 Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.
21269460 2011 Initial characterization of the human central proteome.
20579638 2010 OGFOD1, a member of the 2-oxoglutarate and iron dependent dioxygenase family, functions in ischemic signaling.
20154146 2010 OGFOD1, a novel modulator of eukaryotic translation initiation factor 2alpha phosphorylation and the cellular response to stress.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...