Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.80
PubTator Score 5.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.4e-07
cystic fibrosis 1696 5.0e-05
osteosarcoma 7950 9.7e-05
posterior fossa group A ependymoma 468 3.0e-03

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis 1.282 5.0e-05
osteosarcoma 1.004 9.7e-05
posterior fossa group A ependymoma 1.300 3.0e-03
psoriasis 1.400 1.4e-07

Gene RIF (4)

AA Sequence

MVNDRWKTMGGAAQLEDRPRDKPQRPSCGYVLCTVLLALAVLLAVAVTGAVLFLNHAHAPGTAPPPVVST      1 - 70
GAASANSALVTVERADSSHLSILIDPRCPDLTDSFARLESAQASVLQALTEHQAQPRLVGDQEQELLDTL     71 - 140
ADQLPRLLARASELQTECMGLRKGHGTLGQGLSALQSEQGRLIQLLSESQGHMAHLVNSVSDILDALQRD    141 - 210
RGLGRPRNKADLQRAPARGTRPRGCATGSRPRDCLDVLLSGQQDDGVYSVFPTHYPAGFQVYCDMRTDGG    211 - 280
GWTVFQRREDGSVNFFRGWDAYRDGFGRLTGEHWLGLKRIHALTTQAAYELHVDLEDFENGTAYARYGSF    281 - 350
GVGLFSVDPEEDGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLN    351 - 420
GQYLRGAHASYADGVEWSSWTGWQYSLKFSEMKIRPVREDR                                 421 - 461
//

Text Mined References (10)

PMID Year Title