Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.55
PubTator Score 5.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 1.37949664884765E-7
cystic fibrosis 1670 4.98938883636355E-5
osteosarcoma 7933 9.70775545227278E-5
posterior fossa group A ependymoma 1511 0.00299453178773839

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 1.004 0.000
cystic fibrosis 1.282 0.000
posterior fossa group A ependymoma 1.300 0.003
psoriasis 1.400 0.000

Synonym

Accession Q8N539 A3KFK0 Q6UXK6 Q96SJ7
Symbols

Gene

PANTHER Protein Class (1)

PDB

4M7F   4M7H  

  Ortholog (10)

Pathway (1)

Gene RIF (4)

PMID Text
24293368 The high affinity ligand N-acetylmannosamine (ManNAc) binds FIBCD1 in the S1 site, predominantly via the acetyl group with the oxygen and acetamide nitrogen hydrogen-bonded to the protein and the methyl group inserted into a hydrophobic pocket.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19892701 The recognition unit of FIBCD1 organizes into a noncovalently linked tetrameric structure and uses a hydrophobic funnel (S1) for acetyl group recognition.
19710473 FIBCD1 is a high-affinity receptor for chitin and chitin fragments, and may play an important role in controlling the exposure of intestine to chitin and chitin fragments

AA Sequence

MVNDRWKTMGGAAQLEDRPRDKPQRPSCGYVLCTVLLALAVLLAVAVTGAVLFLNHAHAPGTAPPPVVST      1 - 70
GAASANSALVTVERADSSHLSILIDPRCPDLTDSFARLESAQASVLQALTEHQAQPRLVGDQEQELLDTL     71 - 140
ADQLPRLLARASELQTECMGLRKGHGTLGQGLSALQSEQGRLIQLLSESQGHMAHLVNSVSDILDALQRD    141 - 210
RGLGRPRNKADLQRAPARGTRPRGCATGSRPRDCLDVLLSGQQDDGVYSVFPTHYPAGFQVYCDMRTDGG    211 - 280
GWTVFQRREDGSVNFFRGWDAYRDGFGRLTGEHWLGLKRIHALTTQAAYELHVDLEDFENGTAYARYGSF    281 - 350
GVGLFSVDPEEDGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLN    351 - 420
GQYLRGAHASYADGVEWSSWTGWQYSLKFSEMKIRPVREDR                                 421 - 461
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24293368 2014 Crystal structure of the tetrameric fibrinogen-like recognition domain of fibrinogen C domain containing 1 (FIBCD1) protein.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19892701 2010 The recognition unit of FIBCD1 organizes into a noncovalently linked tetrameric structure and uses a hydrophobic funnel (S1) for acetyl group recognition.
19710473 2009 Characterization of FIBCD1 as an acetyl group-binding receptor that binds chitin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.