Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q8N535
Symbols C2orf52

 Compartment GO Term (0)

 GWAS Trait (1)

AA Sequence

MSEAKDNGSRDEVLVPHKNCRKNTTVPGKKGEEKSLAPVFAEKLISPSRRGAKLKDRESHQENEDRNSEL      1 - 70
DQDEEDKESFCRGFPMSGCELETSCCVCHSTALGERFC                                     71 - 108
//

Text Mined References (4)

PMID Year Title