Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 1.5e-13
malignant mesothelioma 3232 1.8e-05
osteosarcoma 7950 2.4e-04
medulloblastoma, large-cell 6241 1.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 1.400 1.5e-13
malignant mesothelioma 1.300 1.8e-05
medulloblastoma, large-cell 1.100 1.2e-02
osteosarcoma -1.140 2.4e-04

Synonym

Accession Q8N531 Q53G43 Q9H5W9 Q9UKC7
Symbols FBL6
FBL6A
PP14630

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQRRASRRTPRQ      1 - 70
PPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEILVQIFGLLVAADGPMPFLGRA     71 - 140
ARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKKLLASLEWLMPNRFSQLQRLTLIHWKSQVHP    141 - 210
VLKLVGECCPRLTFLKLSGCHGVTADALVMLAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLT    211 - 280
YSSQTTAILGALLGSCCPQLQVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVA    281 - 350
PGPGFPSLEELCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGT    351 - 420
SDRLTLAKEGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNLRGTRVTPSTV    421 - 490
SSVISSCPGLLYLNLESCRCLPRGLKRAYRGLEEVQWCLEQLLTSPSPS                         491 - 539
//

Text Mined References (9)

PMID Year Title