Property Summary

NCBI Gene PubMed Count 7
PubMed Score 10.48
PubTator Score 1.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE IIp 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.3e-06
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 54 0.0 4.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.599 2.3e-06

Gene RIF (2)

AA Sequence

MASSLLAGERLVRALGPGGELEPERLPRKLRAELEAALGKKHKGGDSSSGPQRLVSFRLIRDLHQHLRER      1 - 70
DSKLYLHELLEGSEIYLPEVVKPPRNPELVARLEKIKIQLANEEYKRITRNVTCQDTRHGGTLSDLGKQV     71 - 140
RSLKALVITIFNFIVTVVAAFVCTYLGSQYIFTEMASRVLAALIVASVVGLAELYVMVRAMEGELGEL      141 - 208
//

Text Mined References (10)

PMID Year Title