Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.20
PubTator Score 0.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 4.8e-02
Disease Target Count Z-score Confidence
Choroideremia 16 4.323 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 1.500 4.8e-02

AA Sequence

MEAEGCRYQFRVALLGDAAVGKTSLLRSYVAGAPGAPEPEPEPEPTVGAECYRRALQLRAGPRVKLQLWD      1 - 70
TAGHERFRCITRSFYRNVVGVLLVFDVTNRKSFEHIQDWHQEVMATQGPDKVIFLLVGHKSDLQSTRCVS     71 - 140
AQEAEELAASLGMAFVETSVKNNCNVDLAFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRK    141 - 210
QHSGPCQC                                                                  211 - 218
//

Text Mined References (4)

PMID Year Title