Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.20
PubTator Score 0.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 0.0475044589756311
Disease Target Count Z-score Confidence
Choroideremia 13 4.305 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 1.500 0.048

Synonym

Accession Q8N4Z0 B2R5G2
Symbols

Gene

  Ortholog (1)

Species Source
Macaque OMA EggNOG

AA Sequence

MATQGPDKVIFLLVGHKSDLQSTRCVSAQEAEELAASLGMAFVETSVKNNCNVDLAFDTLADAIQQALQQ      1 - 70
GDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC                                        71 - 105
//

Text Mined References (4)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.