Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.17
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 3.39692703932996E-29
osteosarcoma 7933 6.91476062839591E-10
ovarian cancer 8492 1.44553820160484E-6
sonic hedgehog group medulloblastoma 1482 0.00213216117650073
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00515037163026555
inflammatory breast cancer 404 0.00621302707989075
ductal carcinoma in situ 1745 0.00883022567750922
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0144713977951056
primary Sjogren syndrome 789 0.0374431577107509
Disease Target Count Z-score Confidence
Bronchitis 44 3.256 1.6

Expression

Synonym

Accession Q8N4Y2 D5LPR2 Q8NBW8
Symbols EFCAB4A

Gene

  Ortholog (9)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

AA Sequence

MASPGKPGADEAQEEEGELEGGSAGPRAAILEQAEELFLLCDKEAKGFITKHDLQGLQSDLPLTPEQLEA      1 - 70
VFESLDRAHTGFLTAREFCLGLGMFVGVASAQGANPCRTPEETFESGGLDVQGTAGSLDEEEEEEERFHT     71 - 140
VLEQLGVAPVLGKQRAVRTLWARLQRERPELLGSFEDVLIRASACLEEAARERDGLEQALRRRESEHERE    141 - 210
VRALYEETEQLREQSRRPPSQNFARGERRSRLELELQSREQDLERAGLRQRELEQQLHAQAAEHLEAQAQ    211 - 280
NSQLWRAHEALRTQLEGAQEQIRRLESEARGRQEQTQRDVVAVSRNMQKEKVSLLRQLELLRELNTRLRD    281 - 350
DRDACEARRAGSSCRKALTTARLPGPTCCCCCCWARPPRRGSGHLPSAR                         351 - 399
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25241909 2014 Genetic susceptibility for chronic bronchitis in chronic obstructive pulmonary disease.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20418871 2010 A novel EF-hand protein, CRACR2A, is a cytosolic Ca2+ sensor that stabilizes CRAC channels in T cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...