Property Summary

NCBI Gene PubMed Count 24
PubMed Score 19.46
PubTator Score 18.47

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N4X5 A8K6P7 B3KVQ8 Q2UZW3 Q8TB54 Q96PX4 Q96SY5 AFAP1-like protein 2
Symbols XB130
KIAA1914
CTB-1144G6.4

Gene

PDB

2COF  

Gene RIF (15)

PMID Text
26446840 Results suggest that Tks5, similar to XB130, plays a role in cell proliferation and cell survival and that the interaction between XB130 and Tks5 appears to be critical for regulation of Src-mediated cellular homeostasis.
26191231 XB130 could be useful as a prognostic marker of recurrence-free and overall survival in invasive ductal breast cancer, as well as for the response to chemotherapy.
26045762 This is the first study to reveal that XB130 overexpression may be related to the prediction of metastasis potency and poor prognosis for osteosarcoma patients
25980441 XB130 is a mediator for nicotine-derived nitrosamine ketone-induced cell migration through its translocation to cell motility related microfilamentous cellular structures.
25892537 Results showed significant interaction between variants at TERF1 and AFAP1L2 loci. Given the key role of TERF1 in telomere biology and its physical interaction with AFAP1L2, these results support a role for telomere dysfunction in melanoma development.
24581082 High XB130 expression is associated with pancreatic ductal adenocarcinoma.
24387290 XB130 enhances cell motility and invasiveness by modulating the epithelial-mesenchymal transition-like process.
23527086 XB130 could promote growth of cancer cells by regulating expression of tumor suppressive miRNAs and their targeted genes.
22928011 XB130 is a substrate of multiple protein tyrosine kinases, and it can regulate cell proliferation and survival through modulating selected down-stream signals of PI3K/Akt pathway
22927913 reduced XB130 protein expression is a prognostic biomarker for shorter survival and a higher recurrence rate in patients with gastric cancer
More...

AA Sequence

MERYKALEQLLTELDDFLKILDQENLSSTALVKKSCLAELLRLYTKSSSSDEEYIYMNKVTINKQQNAES      1 - 70
QGKAPEEQGLLPNGEPSQHSSAPQKSLPDLPPPKMIPERKQLAIPKTESPEGYYEEAEPYDTSLNEDGEA     71 - 140
VSSSYESYDEEDGSKGKSAPYQWPSPEAGIELMRDARICAFLWRKKWLGQWAKQLCVIKDNRLLCYKSSK    141 - 210
DHSPQLDVNLLGSSVIHKEKQVRKKEHKLKITPMNADVIVLGLQSKDQAEQWLRVIQEVSGLPSEGASEG    211 - 280
NQYTPDAQRFNCQKPDIAEKYLSASEYGSSVDGHPEVPETKDVKKKCSAGLKLSNLMNLGRKKSTSLEPV    281 - 350
ERSLETSSYLNVLVNSQWKSRWCSVRDNHLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHK    351 - 420
GEELAKLEAKSSEEMGHWLGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSEPNTYI    421 - 490
DGLPSQDRQEELYDDVDLSELTAAVEPTEEATPVADDPNERESDRVYLDLTPVKSFLHGPSSAQAQASSP    491 - 560
TLSCLDNATEALPADSGPGPTPDEPCIKCPENLGEQQLESLEPEDPSLRITTVKIQTEQQRISFPPSCPD    561 - 630
AVVATPPGASPPVKDRLRVTSAEIKLGKNRTEAEVKRYTEEKERLEKKKEEIRGHLAQLRKEKRELKETL    631 - 700
LKCTDKEVLASLEQKLKEIDEECRGEESRRVDLELSIMEVKDNLKKAEAGPVTLGTTVDTTHLENVSPRP    701 - 770
KAVTPASAPDCTPVNSATTLKNRPLSVVVTGKGTVLQKAKEWEKKGAS                          771 - 818
//

Text Mined References (27)

PMID Year Title
26446840 2015 XB130/Tks5 scaffold protein interaction regulates Src-mediated cell proliferation and survival.
26191231 2015 Expression of XB130 in human ductal breast cancer.
26045762 2015 XB130 expression in human osteosarcoma: a clinical and experimental study.
25980441 2015 XB130 translocation to microfilamentous structures mediates NNK-induced migration of human bronchial epithelial cells.
25892537 2015 Integrated pathway and epistasis analysis reveals interactive effect of genetic variants at TERF1 and AFAP1L2 loci on melanoma risk.
24581082 2014 Prognostic significance of XB130 expression in surgically resected pancreatic ductal adenocarcinoma.
24387290 2014 XB130 promotes proliferation and invasion of gastric cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23527086 2013 XB130, a new adaptor protein, regulates expression of tumor suppressive microRNAs in cancer cells.
22928011 2012 XB130 mediates cancer cell proliferation and survival through multiple signaling events downstream of Akt.
More...