Property Summary

NCBI Gene PubMed Count 3
Grant Count 5
R01 Count 4
Funding $658,809.61
PubMed Score 61.53
PubTator Score 16.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
19460752 Knockdown of DnaJ (Hsp40) homolog, subfamily C, member 22 (DNAJC22) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRAQGQRQSPR      1 - 70
GVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFL     71 - 140
TSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSALCNTAATLSY    141 - 210
VAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQ    211 - 280
VLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR             281 - 341
//

Text Mined References (4)

PMID Year Title
17558392 2007 Wurst is essential for airway clearance and respiratory-tube size control.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.