Property Summary

NCBI Gene PubMed Count 3
PubMed Score 65.56
PubTator Score 16.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer 1.100 2.0e-03
ependymoma 1.300 4.3e-07
glioblastoma 1.100 6.1e-04
intraductal papillary-mucinous carcinoma... 1.300 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.700 5.2e-04
lung adenocarcinoma 1.400 5.0e-07
lung carcinoma 1.500 1.7e-15
malignant mesothelioma -1.800 4.2e-06
osteosarcoma 2.073 8.8e-03
pancreatic ductal adenocarcinoma liver m... -1.228 1.1e-02
pediatric high grade glioma 1.400 1.1e-04
primitive neuroectodermal tumor 1.300 3.6e-03
ulcerative colitis -1.100 8.4e-06

Synonym

Accession Q8N4W6 B3KP54
Symbols wus

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRAQGQRQSPR      1 - 70
GVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFL     71 - 140
TSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSALCNTAATLSY    141 - 210
VAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQ    211 - 280
VLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR             281 - 341
//

Text Mined References (4)

PMID Year Title