Property Summary

NCBI Gene PubMed Count 3
PubMed Score 61.53
PubTator Score 16.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.70128600375875E-15
malignant mesothelioma 3163 3.23249212288131E-9
posterior fossa group A ependymoma 1511 6.53651581409695E-8
lung adenocarcinoma 2714 4.99506268274258E-7
ulcerative colitis 2087 8.41330366138823E-6
glioblastoma 5572 2.20157534760164E-5
pediatric high grade glioma 2712 1.10725189402455E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.23837628980594E-4
Breast cancer 3099 0.0019804935077135
primitive neuroectodermal tumor 3031 0.00357543898734018
osteosarcoma 7933 0.00875530681621131
pancreatic ductal adenocarcinoma liver metastasis 1795 0.010602297440695
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0154530237056768
Disease Target Count Z-score Confidence
Barrett's esophagus 185 3.419 1.7
Oral candidiasis 9 3.389 1.7

Expression

Synonym

Accession Q8N4W6 B3KP54
Symbols wus

Gene

  Ortholog (12)

Gene RIF (1)

PMID Text
19460752 Knockdown of DnaJ (Hsp40) homolog, subfamily C, member 22 (DNAJC22) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQANRAQGQRQSPR      1 - 70
GVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLLVAAVGNQTSDFKNTLGSAFL     71 - 140
TSPIFYGRPIAILPISVAASITAQRHRRYKALVASEPLSVRLYRLGLAYLAFTGPLAYSALCNTAATLSY    141 - 210
VAETFGSFLNWFSFFPLLGRLMEFVLLLPYRIWRLLMGETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQ    211 - 280
VLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPWGSRR             281 - 341
//

Text Mined References (4)

PMID Year Title
17558392 2007 Wurst is essential for airway clearance and respiratory-tube size control.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.