Property Summary

NCBI Gene PubMed Count 5
Grant Count 2
Funding $77,220
PubMed Score 4.29
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q8N4V2 Q9NPW5 SV2-related protein
Symbols

Gene

 Grant Application (2)

AA Sequence

MEEDLFQLRQLPVVKFRRTGESARSEDDTASGEHEVQIEGVHVGLEAVELDDGAAVPKEFANPTDDTFMV      1 - 70
EDAVEAIGFGKFQWKLSVLTGLAWMADAMEMMILSILAPQLHCEWRLPSWQVALLTSVVFVGMMSSSTLW     71 - 140
GNISDQYGRKTGLKISVLWTLYYGILSAFAPVYSWILVLRGLVGFGIGGVPQSVTLYAEFLPMKARAKCI    141 - 210
LLIEVFWAIGTVFEVVLAVFVMPSLGWRWLLILSAVPLLLFAVLCFWLPESARYDVLSGNQEKAIATLKR    211 - 280
IATENGAPMPLGKLIISRQEDRGKMRDLFTPHFRWTTLLLWFIWFSNAFSYYGLVLLTTELFQAGDVCGI    281 - 350
SSRKKAVEAKCSLACEYLSEEDYMDLLWTTLSEFPGVLVTLWIIDRLGRKKTMALCFVIFSFCSLLLFIC    351 - 420
VGRNVLTLLLFIARAFISGGFQAAYVYTPEVYPTATRALGLGTCSGMARVGALITPFIAQVMLESSVYLT    421 - 490
LAVYSGCCLLAALASCFLPIETKGRGLQESSHREWGQEMVGRGMHGAGVTRSNSGSQE                491 - 548
//

Text Mined References (7)

PMID Year Title
21953179 2012 Comparative genomics and functional analysis of the NiaP family uncover nicotinate transporters from bacteria, plants, and mammals.
19390693 2009 SVOP is a nucleotide binding protein.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17714910 2007 Identification of six putative human transporters with structural similarity to the drug transporter SLC22 family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9801366 1998 SVOP, an evolutionarily conserved synaptic vesicle protein, suggests novel transport functions of synaptic vesicles.