Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
ovarian cancer 8,484

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.500 0.000

Synonym

Accession Q8N4V1 B2R625 B4DIY3 D3DWG7 Q5JPP7
Symbols EMC5
TMEM32

Gene

Gene RIF (1)

PMID Text
22190034 HIV-1 gp41 is identified to have a physical interaction with membrane magnesium transporter 1 (MMGT1; TMEM32) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDM      1 - 70
DATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR              71 - 131
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22119785 2011 Defining human ERAD networks through an integrative mapping strategy.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18057121 2008 Identification and characterization of a novel family of membrane magnesium transporters, MMgT1 and MMgT2.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...