Property Summary

NCBI Gene PubMed Count 10
PubMed Score 41.37
PubTator Score 49.88

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N4T8 Q8WTW8 Q96K93
Symbols SDR45C1

Gene

PANTHER Protein Class (2)

PDB

4CQL   4CQM  

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19571038 Hs17beta-HSD8 and HsCBR4 show a strong genetic interaction in vivo in yeast, where, only if they are expressed together, they rescue the respiratory deficiency and restore the lipoic acid content of oar1Delta cells.
19000905 CBR4 is a mitochondrial NADPH-dependent reductase for o- and p-quinones.

AA Sequence

MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEEL      1 - 70
EKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLK     71 - 140
GNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVA    141 - 210
HAVVFLLESPYITGHVLVVDGGLQLIL                                               211 - 237
//

Text Mined References (16)

PMID Year Title
25203508 2014 Insights into mitochondrial fatty acid synthesis from the structure of heterotetrameric 3-ketoacyl-ACP reductase/3R-hydroxyacyl-CoA dehydrogenase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20837989 2010 Naturally occurring variants of human aldo-keto reductases with reduced in vitro metabolism of daunorubicin and doxorubicin.
19571038 2009 17beta-hydroxysteroid dehydrogenase type 8 and carbonyl reductase type 4 assemble as a ketoacyl reductase of human mitochondrial FAS.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
19000905 2008 Human carbonyl reductase 4 is a mitochondrial NADPH-dependent quinone reductase.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...