Property Summary

NCBI Gene PubMed Count 10
PubMed Score 48.52
PubTator Score 49.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 2.800 1.2e-03
ependymoma 2.400 4.3e-03
gastric cancer 1.300 9.7e-04
group 3 medulloblastoma 1.200 8.3e-03
hepatocellular carcinoma 1.300 8.9e-06
intraductal papillary-mucinous adenoma (... 1.600 1.5e-04
intraductal papillary-mucinous carcinoma... 1.500 2.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 5.2e-03
lung carcinoma 1.100 2.7e-12
oligodendroglioma 2.900 1.4e-03
osteosarcoma -1.973 3.2e-05
ovarian cancer -2.600 3.5e-14
Pick disease 1.300 1.2e-05
primitive neuroectodermal tumor 1.500 1.3e-04
progressive supranuclear palsy -1.100 5.1e-03

Gene RIF (3)

AA Sequence

MDKVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLAFSCDVAKEHDVQNTFEEL      1 - 70
EKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLK     71 - 140
GNSGQSVYSASKGGLVGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGETIEVA    141 - 210
HAVVFLLESPYITGHVLVVDGGLQLIL                                               211 - 237
//

Text Mined References (16)

PMID Year Title