Property Summary

NCBI Gene PubMed Count 17
PubMed Score 62.46
PubTator Score 298.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis -2.000 1.6e-03
intraductal papillary-mucinous adenoma (... 2.900 1.0e-03
psoriasis 3.200 9.7e-35
ulcerative colitis -1.100 3.3e-04
urothelial carcinoma -2.600 1.2e-23

Gene RIF (11)

AA Sequence

MKCLGKRRGQAAAFLPLCWLFLKILQPGHSHLYNNRYAGDKVIRFIPKTEEEAYALKKISYQLKVDLWQP      1 - 70
SSISYVSEGTVTDVHIPQNGSRALLAFLQEANIQYKVLIEDLQKTLEKGSSLHTQRNRRSLSGYNYEVYH     71 - 140
SLEEIQNWMHHLNKTHSGLIHMFSIGRSYEGRSLFILKLGRRSRLKRAVWIDCGIHAREWIGPAFCQWFV    141 - 210
KEALLTYKSDPAMRKMLNHLYFYIMPVFNVDGYHFSWTNDRFWRKTRSRNSRFRCRGVDANRNWKVKWCD    211 - 280
EGASMHPCDDTYCGPFPESEPEVKAVANFLRKHRKHIRAYLSFHAYAQMLLYPYSYKYATIPNFRCVESA    281 - 350
AYKAVNALQSVYGVRYRYGPASTTLYVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFLLPEMLIKPTCTE    351 - 420
TMLAVKNITMHLLKKCP                                                         421 - 437
//

Text Mined References (17)

PMID Year Title