Property Summary

NCBI Gene PubMed Count 23
Grant Count 12
R01 Count 4
Funding $593,309.33
PubMed Score 63.90
PubTator Score 49.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
astrocytic glioma 2,241
ependymoma 2,514

Expression

  Differential Expression (2)

Disease log2 FC p
astrocytic glioma -1.100 0.029
ependymoma -1.100 0.036

Gene RIF (16)

PMID Text
26589182 Data show that the redox state of cytochrome c oxidase assembly protein 17 (Cox17), mitochondrial membrane transport protein Mia40 and superoxide dismutase 1 (SOD1) in the cytoplasm were directly observed with in-cell NMR spectroscopy.
26275620 results demonstrate an indispensable role for hMIA40 for the export of Fe-S clusters from mitochondria.
26178476 Compared to wild type control littermates, mice with a knockout of CHCHD4 exhibit reduced weight gain when fed a high-fat diet.
26158520 our findings suggest that MIA40 reduction contributes to the effects of AIF deficiency on OXPHOS, as it may impact on the correct assembly and maintenance of the respiratory subunits.
26014136 In aggregate these data suggest that the Mia40/lfALR system has a broad sequence specificity and that potential substrates may be protected from adventitious oxidation by kinetic sequestration within the mitochondrial IMS.
26004228 Data indicate that poptosis-inducing factor (AIF) controls the mitochondrial import of mitochondrial membrane transport protein CHCHD4.
24101517 Data indicate that decreased CHCHD4 expression prevents the mitochondrial translocation of p53 while augmenting its nuclear localization and activity.
23937629 illustrate a very atypical behaviour for the Mia40 precursor compared to other substrates of the MIA pathway. By contrast, interaction with Erv1 occurs after 5 min of import and relies on a more stringent specificity
23676665 Import and oxidative folding of proteins are kinetically and functionally coupled and depend on the expression of Mia40, ALR, and the intracellular glutathione pool.
23186364 mitochondrial localization of MIA40 requires sulfhydryl oxidase ALR in heterologous expression yeast system.
More...

AA Sequence

MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKS      1 - 70
AFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEG     71 - 140
SS                                                                        141 - 142
//

Text Mined References (27)

PMID Year Title
26589182 2016 Direct structural evidence of protein redox regulation obtained by in-cell NMR.
26387864 2015 The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake.
26275620 2015 Human mitochondrial MIA40 (CHCHD4) is a component of the Fe-S cluster export machinery.
26178476 2015 Metabolic epistasis among apoptosis-inducing factor and the mitochondrial import factor CHCHD4.
26158520 2015 Loss of apoptosis-inducing factor critically affects MIA40 function.
26014136 2015 Mia40 is a facile oxidant of unfolded reduced proteins but shows minimal isomerase activity.
26004228 2015 Interaction between AIF and CHCHD4 Regulates Respiratory Chain Biogenesis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24101517 2013 Mitochondrial disulfide relay mediates translocation of p53 and partitions its subcellular activity.
More...