Property Summary

NCBI Gene PubMed Count 4
PubMed Score 5.27
PubTator Score 9.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 8.90684717021353E-15
atypical teratoid/rhabdoid tumor 1095 6.82408109726604E-9
glioblastoma 5572 2.50346316561402E-6
pilocytic astrocytoma 3086 1.67926139723911E-5
pediatric high grade glioma 2712 4.80829624427368E-5
sonic hedgehog group medulloblastoma 1482 1.24484953659763E-4
primitive neuroectodermal tumor 3031 0.00216453758994674
medulloblastoma, large-cell 6234 0.00501826467360379
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00758486411200068
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0309944668889006
Disease Target Count Z-score Confidence
Hydrocephalus 60 3.582 1.8

Expression

Synonym

Accession Q8N4P2 Q63HQ1 Q96NE6 TPR repeat protein 30B
Symbols IFT70
fleer
IFT70B

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Cow OMA Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG
C. elegans OMA EggNOG
Fruitfly EggNOG Inparanoid

AA Sequence

MAGLSGAQIPDGEFTAVVYRLIRNARYAEAVQLLGGELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQ      1 - 70
LGQLHPELEQYRLYQAQALYKACLYAEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLP     71 - 140
SREGGEESGGENETDGQINLGCLLYKEGQYEAACSKFFAALQASGYQPDLSYNLALAYYSSRQYASALKH    141 - 210
IAEIIERGIRQHPELGVGMTTEGIDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEAAQEALTDMPPR    211 - 280
AEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLI    281 - 350
YKFLTPYLYDFLDAVITCQTAPEEAFIKLDGLAGMLTEVLRKLTIQVQEARHNRDDEAIKKAVNEYDETM    351 - 420
EKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHY    421 - 490
DNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDPDKKMYHLCIVNLVIGTLYCAKGNY    491 - 560
DFGISRVIKSLEPYNKKLGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELHGRNIPAVI    561 - 630
EQPLEEERMHVGKNTVTYESRQLKALIYEIIGWNI                                       631 - 665
//

Text Mined References (7)

PMID Year Title
21602787 2011 Nephrocystins and MKS proteins interact with IFT particle and facilitate transport of selected ciliary cargos.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.