Property Summary

NCBI Gene PubMed Count 14
Grant Count 6
R01 Count 6
Funding $1,868,279
PubMed Score 3.80
PubTator Score 8.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

Expression

Gene RIF (9)

PMID Text
23087211 Data indicate that Cep170 association with the C-terminus of Kif2b enhances localization of Kif2b to the spindle.
22535524 Data show that Polo-like kinase 1 (Plk1) regulates both the localization and activity of kinesin-13 protein Kif2b during mitosis to promote the correction of k-MT attachment errors to ensure mitotic fidelity.
20950786 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20852589 Data show that CLASP1-astrin-Kif2b complex acts as a central switch at kinetochores that defines mitotic progression and promotes fidelity by temporally regulating kinetochore-microtuble attachments.
19060894 Here we show that two microtubule-depolymerizing kinesins, Kif2b and MCAK, stimulate kinetochore-microtubule dynamics during distinct phases of mitosis to correct mal-orientations.
18976975 Knockdown of kinesin family member 2B (KIF2B) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17538014 These data demonstrate that Kif2b function is required for spindle assembly and chromosome movement and that the microtubule depolymerase activities of Kif2a, Kif2b, and MCAK fulfill distinct functions during mitosis in human cells.
12893827 kinesin-I-dependent neuronal AbetaPP transport, which controls AbetaPP processing, may be regulated by JIP1
12368902 when microtubules are absent, the neck linker exists in equilibrium between two structural states; microtubule binding may activate the nucleotide-sensing mechanism of kinesin

AA Sequence

MASQFCLPESPCLSPLKPLKPHFGDIQEGIYVAIQRSDKRIHLAVVTEINRENYWVTVEWVEKAVKKGKK      1 - 70
IDLETILLLNPALDSAEHPMPPPPLSPLALAPSSAIRDQRTATKWVAMIPQKNQTASGDSLDVRVPSKPC     71 - 140
LMKQKKSPCLWEIQKLQEQREKRRRLQQEIRARRALDVNTRNPNYEIMHMIEEYRRHLDSSKISVLEPPQ    141 - 210
EHRICVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTFCFDHAFDDKASNELVY    211 - 280
QFTAQPLVESIFRKGMATCFAYGQTGSGKTYTMGGDFSGTAQDCSKGIYALVAQDVFLLLRNSTYEKLDL    281 - 350
KVYGTFFEIYGGKVYDLLNWKKKLQVLEDGNQQIQVVGLQEKEVCCVEEVLNLVEIGNSCRTSRQTPVNA    351 - 420
HSSRSHAVFQIILKSGRIMHGKFSLVDLAGNERGADTTKASRKRQLEGAEINKSLLALKECILALGQNKP    421 - 490
HTPFRASKLTLVLRDSFIGQNSSTCMIATISPGMTSCENTLNTLRYANRVKKLNVDVRPYHRGHYPIGHE    491 - 560
APRMLKSHIGNSEMSLQRDEFIKIPYVQSEEQKEIEEVETLPTLLGKDTTISGKGSSQWLENIQERAGGV    561 - 630
HHDIDFCIARSLSILEQKIDALTEIQKKLKLLLADLHVKSKVE                               631 - 673
//

Text Mined References (15)

PMID Year Title
23891108 2013 Lateral to end-on conversion of chromosome-microtubule attachment requires kinesins CENP-E and MCAK.
23087211 2012 The microtubule-binding protein Cep170 promotes the targeting of the kinesin-13 depolymerase Kif2b to the mitotic spindle.
22535524 2012 Plk1 regulates the kinesin-13 protein Kif2b to promote faithful chromosome segregation.
20950786 2010 A genome-wide study reveals copy number variants exclusive to childhood obesity cases.
20852589 2010 CLASP1, astrin and Kif2b form a molecular switch that regulates kinetochore-microtubule dynamics to promote mitotic progression and fidelity.
19060894 2009 Genome stability is ensured by temporal control of kinetochore-microtubule dynamics.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17538014 2007 The kinesin-13 proteins Kif2a, Kif2b, and Kif2c/MCAK have distinct roles during mitosis in human cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...