Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.80
PubTator Score 8.41

Knowledge Summary

Patent

No data available

TINX Plot

Expression

 GWAS Trait (1)

Gene RIF (9)

AA Sequence

MASQFCLPESPCLSPLKPLKPHFGDIQEGIYVAIQRSDKRIHLAVVTEINRENYWVTVEWVEKAVKKGKK      1 - 70
IDLETILLLNPALDSAEHPMPPPPLSPLALAPSSAIRDQRTATKWVAMIPQKNQTASGDSLDVRVPSKPC     71 - 140
LMKQKKSPCLWEIQKLQEQREKRRRLQQEIRARRALDVNTRNPNYEIMHMIEEYRRHLDSSKISVLEPPQ    141 - 210
EHRICVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTFCFDHAFDDKASNELVY    211 - 280
QFTAQPLVESIFRKGMATCFAYGQTGSGKTYTMGGDFSGTAQDCSKGIYALVAQDVFLLLRNSTYEKLDL    281 - 350
KVYGTFFEIYGGKVYDLLNWKKKLQVLEDGNQQIQVVGLQEKEVCCVEEVLNLVEIGNSCRTSRQTPVNA    351 - 420
HSSRSHAVFQIILKSGRIMHGKFSLVDLAGNERGADTTKASRKRQLEGAEINKSLLALKECILALGQNKP    421 - 490
HTPFRASKLTLVLRDSFIGQNSSTCMIATISPGMTSCENTLNTLRYANRVKKLNVDVRPYHRGHYPIGHE    491 - 560
APRMLKSHIGNSEMSLQRDEFIKIPYVQSEEQKEIEEVETLPTLLGKDTTISGKGSSQWLENIQERAGGV    561 - 630
HHDIDFCIARSLSILEQKIDALTEIQKKLKLLLADLHVKSKVE                               631 - 673
//

Text Mined References (16)

PMID Year Title