Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.1

Expression

  Differential Expression (7)

Disease log2 FC p
gastric cancer 1.100 2.7e-03
glioblastoma -1.100 7.9e-05
invasive ductal carcinoma -1.200 2.5e-02
malignant mesothelioma -1.300 1.5e-05
medulloblastoma, large-cell -1.900 3.8e-05
osteosarcoma -1.081 1.6e-04
ovarian cancer -1.900 1.8e-08

Synonym

Accession Q8N4N3 Q8N5G6 Q9H9U6
Symbols C16orf44

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MMEGSRQTRVSRPYKISESSKVYRWADHSSTVLQRLNEQRLRGLFCDVVLVADEQRVPAHRNLLAVCSDY      1 - 70
FNSMFTIGMREAFQKEVELIGASYIGLKAVVDFLYGGELVLDGGNIDYVLETAHLLQIWTVVDFCCEYLE     71 - 140
QEVSEDNYLYLQELASIYSLKRLDAFIDGFILNHFGTLSFTPDFLQNVSMQKLCVYLSSSEVQRECEHDL    141 - 210
LQAALQWLTQQPEREAHARQVLENIHFPLIPKNDLLHRVKPAVCSLLPKEANCEGFIEEAVRYHNNLAAQ    211 - 280
PVMQTKRTALRTNQERLLFVGGEVSERCLELSDDTCYLDAKSEQWVKETPLPARRSHHCVAVLGGFIFIA    281 - 350
GGSFSRDNGGDAASNLLYRYDPRCKQWIKVASMNQRRVDFYLASIEDMLVAIGGRNENGALSSVETYSPK    351 - 420
TDSWSYVAGLPRFTYGHAGTIYKDFVYISGGHDYQIGPYRKNLLCYDHRTDVWEERRPMTTARGWHSMCS    421 - 490
LGDSIYSIGGSDDNIESMERFDVLGVEAYSPQCNQWTRVAPLLHANSESGVAVWEGRIYILGGYSWENTA    491 - 560
FSKTVQVYDREADKWSRGVDLPKAIAGGSACVCALEPRPEDKKKKGKGKRHQDRGQ                  561 - 616
//

Text Mined References (6)

PMID Year Title