Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q8N4M7 Q5T2Z8
Symbols bA492M23.1

 Compartment GO Term (0)

AA Sequence

MNHCIQFSPQSLQRWLILPCYDLKLPIWANTTEFCPHGPRRASQDPQLLAWLPDQSLEVSLELYDWNSMT      1 - 70
FTLFLETVEPVAVESEGSGIFSFVWQQLIFPAEARWCFSWAQDCGLDGSFPGSAHTEPFGKAAAGQGSVA     71 - 140
GKEAKKAGPGFHRQLLYLQFQKRCLFNYPELL                                          141 - 172
//

Text Mined References (4)

PMID Year Title