Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.47
PubTator Score 1.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Male infertility 206 4.381 2.2
Primary ciliary dyskinesia 76 3.828 1.9

Expression

AA Sequence

MAMVERPRPEWASYHNCNSNSCQDLGNSVLLLLGLIICINISINIVTLLWSRFRGVLYQVFHDTICEKEA      1 - 70
PKSSLLRKQTQPPKKQSSPAVHLRCTMDPVMMTVSPPPAHRHRRRGSPTRCAHCPVAWAPDTDDEKPHQY     71 - 140
PAICSYHWDVPEDWEGFQHTQGTWVPWSQDAPESPPQTIRFQPTVEERPLKTGIWSELGLRAYVYPVNPP    141 - 210
PPSPEAPSHKNGGEGAVPEAEAAQYQPVPAPTLGPAVIPEFSRHRSSGRIVYDARDMRRRLRELTREVEA    211 - 280
LSGCYPLASGSSTAEETSKNWVYRSLTGR                                             281 - 309
//

Text Mined References (6)

PMID Year Title