Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.31
PubTator Score 1.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

AA Sequence

MAMVERPRPEWASYHNCNSNSCQDLGNSVLLLLGLIICINISINIVTLLWSRFRGVLYQVFHDTICEKEA      1 - 70
PKSSLLRKQTQPPKKQSSPAVHLRCTMDPVMMTVSPPPAHRHRRRGSPTRCAHCPVAWAPDTDDEKPHQY     71 - 140
PAICSYHWDVPEDWEGFQHTQGTWVPWSQDAPESPPQTIRFQPTVEERPLKTGIWSELGLRAYVYPVNPP    141 - 210
PPSPEAPSHKNGGEGAVPEAEAAQYQPVPAPTLGPAVIPEFSRHRSSGRIVYDARDMRRRLRELTREVEA    211 - 280
LSGCYPLASGSSTAEETSKNWVYRSLTGR                                             281 - 309
//

Text Mined References (6)

PMID Year Title
21184802 2011 RANBP17 is localized to the XY body of spermatocytes and interacts with SPEM1 on the manchette of elongating spermatids.
20558241 2010 UBQLN1 interacts with SPEM1 and participates in spermiogenesis.
17426145 2007 Lack of Spem1 causes aberrant cytoplasm removal, sperm deformation, and male infertility.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.