Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.200 8.3e-05
breast carcinoma -1.100 4.2e-04
ductal carcinoma in situ -1.200 3.0e-04
ependymoma -1.400 4.2e-02
fibroadenoma -1.100 3.0e-02
group 3 medulloblastoma -2.100 1.1e-03
medulloblastoma, large-cell -2.500 5.2e-05
ovarian cancer -1.900 7.8e-08
pancreatic cancer 1.100 6.9e-04
pancreatic carcinoma 1.100 6.9e-04
Rheumatoid arthritis 1.300 4.6e-02
tuberculosis 1.400 2.9e-04

Gene RIF (1)

AA Sequence

MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPDASGIPVINCRVCQSLINLDGK      1 - 70
LHQHVVKCTVCNEATPIKNPPTGKKYVRCPCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQ     71 - 140
PALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSALPRRRCCAYITIGMICIFIGVGLT    141 - 210
VGTPDFARRFRATYVSWAIAYLLGLICLIRACYWGAIRVSYPEHSFA                           211 - 257
//

Text Mined References (10)

PMID Year Title