Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.046
pancreatic cancer 1.100 0.001
ependymoma -1.400 0.042
group 4 medulloblastoma -2.400 0.000
medulloblastoma, large-cell -2.500 0.000
tuberculosis 1.400 0.000
breast carcinoma -1.100 0.000
fibroadenoma -1.100 0.030
pancreatic carcinoma 1.100 0.001
Breast cancer -1.200 0.000
ductal carcinoma in situ -1.200 0.000
ovarian cancer -1.900 0.000

Gene

Gene RIF (1)

PMID Text
16365287 identification and characterization of two previously undescribed human enzymes, PtdIns-4,5-P(2) 4-phosphatase type I and type II

AA Sequence

MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPDASGIPVINCRVCQSLINLDGK      1 - 70
LHQHVVKCTVCNEATPIKNPPTGKKYVRCPCNCLLICKDTSRRIGCPRPNCRRIINLGPVMLISEEQPAQ     71 - 140
PALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKISSVGSALPRRRCCAYITIGMICIFIGVGLT    141 - 210
VGTPDFARRFRATYVSWAIAYLLGLICLIRACYWGAIRVSYPEHSFA                           211 - 257
//

Text Mined References (10)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16365287 2005 The identification and characterization of two phosphatidylinositol-4,5-bisphosphate 4-phosphatases.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.