Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
posterior fossa group A ependymoma -2.300 0.000
astrocytoma -1.100 0.000
glioblastoma -1.900 0.000
oligodendroglioma -1.200 0.000
group 4 medulloblastoma -2.200 0.000
atypical teratoid/rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.300 0.000
Amyotrophic Lateral Sclerosis -1.024 0.000
adult high grade glioma -2.400 0.000
pilocytic astrocytoma -1.800 0.000
ovarian cancer -1.400 0.000

AA Sequence

MPEDGAGDGGEVPALIPDGEPLREEQRPLKQSLGSSLCRESHWKCLLLTLLIHACGAVVAWCRLATVPRL      1 - 70
VLGPEAALARGAGGPPPTYPASPCSDGYLYIPLAFVSLLYLLYLAECWHCHVRSCQAPRTDAHTVLALIR     71 - 140
RLQQAPPCVWWKATSYHYVRRTRQITRYRNGDAYTTTQVYHERADSRTARGEFDYSAHGVRDVSKELVGL    141 - 210
AEHAATRLRFTKCFSFGSAEAEASYLTQRARFFSANEGLDDYLEAREGMHLKDVDFRESLMVFADPRSPP    211 - 280
WYARAWVFWLVSAATLSWPLRVVAAYGTAHVHYQVEKLFGASSPPPGAVPSGPPLSRVATVDFTELEWHI    281 - 350
CSNRQLVPSYSEAVVMGAGSGAYLRGCQRCRRSVSSNSLPPARPSGPRLPFSRSRLSLGAGGRATPGVFR    351 - 420
SLSGGPLGRRGEDTEPLESPPCYEDALYFPVLIVHGDSGCQGDGQGAL                          421 - 468
//

Text Mined References (5)

PMID Year Title
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.