Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.44
PubTator Score 4.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q8N4H5 B2DG07 F6S928 Q5JRT7
Symbols Tom5
C9orf105
bA613M10.3

Gene

Gene RIF (1)

PMID Text
18331822 The human counterparts of Tom5 and Tom6, together with the other components including Tom7, were identified in the preprotein translocase complex.

AA Sequence

MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI                         1 - 51
//

Text Mined References (8)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
18331822 2008 Identification of Tom5 and Tom6 in the preprotein translocase complex of human mitochondrial outer membrane.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.