Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.600 4.5e-02
intraductal papillary-mucinous adenoma (... 1.200 3.6e-03

Gene RIF (1)

AA Sequence

MPLEVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAV      1 - 70
VDLLEMWDELAYYEENTRDFLFPEPKLTPSHPRRCREVLMKTALGFPGIAPKIEFSTRTAIRECVFLHRN     71 - 140
RFLEERHESRRPLSTSHEPIFPLNTIKMKLKENNLNRLPKGMQARAPSQYSTRHFFQDQPAQLNLGNNFK    141 - 210
ISGGSKPPFVVRHVDSAKPFGENISEHHLRRSRRKSKFSDFPFPTRRASSLDSLAANVKVIKEPDERIVL    211 - 280
RSDSSSCLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPGSQSTWKNIHERVCS    281 - 350
LLTSHRAQLHQNKEDSTSEVNYIIERPSYPLKKYSLHEQRYF                                351 - 392
//

Text Mined References (8)

PMID Year Title