Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.63
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Acute kidney injury 70 0.0 0.0
Disease Target Count P-value
diabetes mellitus 1728 1.0e-03

AA Sequence

MGFDVLLDQVGGMGRFQICLIAFFCITNILLFPNIVLENFTAFTPSHRCWVPLLDNDSVSDNDTGTLSKD      1 - 70
DLLRISIPLDSNLRPQKCQRFIHPQWQLLHLNGTFPNTNEPDTEPCVDGWVYDRSSFLSTIVTEWDLVCE     71 - 140
SQSLKSMVQSLFMAGSLLGGLIYGHLSDRVGRKIICKLCFLQLAISNTCAAFAPTFLVYCILRFLAGFST    141 - 210
MTILGNTFILSLEWTLPRSRSMTIMVLLCSYSVGQMLLGGLAFAIQDWHILQLTVSTPIIVLFLSSWYEQ    211 - 280
SPHSLPVSEAMVDIERKIVTPGICSVSGLVLSHDVHSTYCVT                                281 - 322
//

Text Mined References (5)

PMID Year Title