Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.63
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

AA Sequence

MGFDVLLDQVGGMGRFQICLIAFFCITNILLFPNIVLENFTAFTPSHRCWVPLLDNDSVSDNDTGTLSKD      1 - 70
DLLRISIPLDSNLRPQKCQRFIHPQWQLLHLNGTFPNTNEPDTEPCVDGWVYDRSSFLSTIVTEWDLVCE     71 - 140
SQSLKSMVQSLFMAGSLLGGLIYGHLSDRVGRKIICKLCFLQLAISNTCAAFAPTFLVYCILRFLAGFST    141 - 210
MTILGNTFILSLEWTLPRSRSMTIMVLLCSYSVGQMLLGGLAFAIQDWHILQLTVSTPIIVLFLSSWYEQ    211 - 280
SPHSLPVSEAMVDIERKIVTPGICSVSGLVLSHDVHSTYCVT                                281 - 322
//

Text Mined References (5)

PMID Year Title
24800985 2014 Genome-wide association study of maternal and inherited loci for conotruncal heart defects.
17714910 2007 Identification of six putative human transporters with structural similarity to the drug transporter SLC22 family.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.