Property Summary

NCBI Gene PubMed Count 5
PubMed Score 309.18
PubTator Score 213.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (2)

PMID Text
19193988 The X-ray crystal structure of the thioredoxin (Trx)-fold domain of PDCL2 has been solved and resembles the Trx-fold domain of rat; the presence of two molecules in an asymmetric unit is suggested.
12424248 This publication pertains to mouse and suggests a role for phosducin-like 2 in germ cell maturation.

AA Sequence

MQDPNEDTEWNDILRDFGILPPKEESKDEIEEMVLRLQKEAMVKPFEKMTLAQLKEAEDEFDEEDMQAVE      1 - 70
TYRKKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEEDVWVIIHLYRSSIPMCLLVNQHLSLLARKFP     71 - 140
ETKFVKAIVNSCIQHYHDNCLPTIFVYKNGQIEAKFIGIIECGGINLKLEELEWKLAEVGAIQTDLEENP    141 - 210
RKDMVDMMVSSIRNTSIHDDSDSSNSDNDTK                                           211 - 241
//

Text Mined References (6)

PMID Year Title
19193988 2009 Structure of the thioredoxin-fold domain of human phosducin-like protein 2.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12424248 2003 A novel germ line-specific gene of the phosducin-like protein (PhLP) family. A meiotic function conserved from yeast to mice.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.