Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MDTILVFSLIIASYDANKKDLRDSSCRLEQLPGIFPKDVRSIRELQMQETHTETKRTTFIQNRTIATLQC      1 - 70
LGSDSKVKVNLVYLERRPKVKHILKNLRIIAAPRRNSSASSSCHLIPTSKFQTGSLLKGKAFLPGISQCK     71 - 140
VLGASSETFPTTAPSITPGNKEGEKTTSTDTDENLEKRQKWSIVVKILIAVTLLLSGVAIIVFVIFEVPC    141 - 210
PYQCLGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKAAEITVIHQTYF         211 - 275
//

Text Mined References (9)

PMID Year Title