Property Summary

NCBI Gene PubMed Count 26
Grant Count 16
R01 Count 13
Funding $1,016,591.17
PubMed Score 112.29
PubTator Score 158.47

Knowledge Summary

Patent (26,509)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -4.200 0.000
osteosarcoma -1.611 0.000
group 3 medulloblastoma -1.500 0.001
astrocytoma 2.300 0.005
medulloblastoma, large-cell -1.800 0.000
pancreatic ductal adenocarcinoma liver m... 1.243 0.009
atypical teratoid/rhabdoid tumor -1.100 0.000
ovarian cancer 1.200 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (9)

PMID Text
25747578 MINK plays a functional role in the IRES-mediated translation of EV71 viral RNA and may provide a potential target for the development of specific antiviral strategies against EV71 infection
22665485 Misshapen-like kinase 1 (MINK1) is a novel component of striatin-interacting phosphatase and kinase (STRIPAK) and is required for the completion of cytokinesis.
22037766 MINK1 interacts with and phosphorylates PRICKLE1 and PRICKLE2.
21048137 MINK interaction with Rap2 plays a critical role in maintaining the morphological integrity of dendrites and synaptic transmission.
18752142 Observational study of gene-disease association. (HuGE Navigator)
17165161 Observational study of gene-disease association. (HuGE Navigator)
16760206 Observational study of gene-disease association. (HuGE Navigator)
15469942 results suggest that human Misshapen/NIKs-related kinase beta (hMINK beta) plays an important role in cytoskeleton reorganization, cell adhesion, and cell motility(hMINKbeta)
12668260 Analysis of the coding region of the NIK gene in progressive supranuclear palsy (PSP) patients through single strand conformation polymorphism and direct sequencing does not support a pathogenic role of the NIK gene in PSP.

AA Sequence

MGDPAPARSLDDIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKQEI      1 - 70
NMLKKYSHHRNIATYYGAFIKKSPPGNDDQLWLVMEFCGAGSVTDLVKNTKGNALKEDCIAYICREILRG     71 - 140
LAHLHAHKVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATY    141 - 210
DYRSDIWSLGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFIDFIDTCLIKTYLSRPPT    211 - 280
EQLLKFPFIRDQPTERQVRIQLKDHIDRSRKKRGEKEETEYEYSGSEEEDDSHGEEGEPSSIMNVPGEST    281 - 350
LRREFLRLQQENKSNSEALKQQQQLQQQQQRDPEAHIKHLLHQRQRRIEEQKEERRRVEEQQRREREQRK    351 - 420
LQEKEQQRRLEDMQALRREEERRQAEREQEYKRKQLEEQRQSERLQRQLQQEHAYLKSLQQQQQQQQLQK    421 - 490
QQQQQLLPGDRKPLYHYGRGMNPADKPAWAREVEERTRMNKQQNSPLAKSKPGSTGPEPPIPQASPGPPG    491 - 560
PLSQTPPMQRPVEPQEGPHKSLVAHRVPLKPYAAPVPRSQSLQDQPTRNLAAFPASHDPDPAIPAPTATP    561 - 630
SARGAVIRQNSDPTSEGPGPSPNPPAWVRPDNEAPPKVPQRTSSIATALNTSGAGGSRPAQAVRARPRSN    631 - 700
SAWQIYLQRRAERGTPKPPGPPAQPPGPPNASSNPDLRRSDPGWERSDSVLPASHGHLPQAGSLERNRVG    701 - 770
VSSKPDSSPVLSPGNKAKPDDHRSRPGRPADFVLLKERTLDEAPRPPKKAMDYSSSSEEVESSEDDEEEG    771 - 840
EGGPAEGSRDTPGGRSDGDTDSVSTMVVHDVEEITGTQPPYGGGTMVVQRTPEEERNLLHADSNGYTNLP    841 - 910
DVVQPSHSPTENSKGQSPPSKDGSGDYQSRGLVKAPGKSSFTMFVDLGIYQPGGSGDSIPITALVGGEGT    911 - 980
RLDQLQYDVRKGSVVNVNPTNTRAHSETPEIRKYKKRFNSEILCAALWGVNLLVGTENGLMLLDRSGQGK    981 - 1050
VYGLIGRRRFQQMDVLEGLNLLITISGKRNKLRVYYLSWLRNKILHNDPEVEKKQGWTTVGDMEGCGHYR   1051 - 1120
VVKYERIKFLVIALKSSVEVYAWAPKPYHKFMAFKSFADLPHRPLLVDLTVEEGQRLKVIYGSSAGFHAV   1121 - 1190
DVDSGNSYDIYIPVHIQSQITPHAIIFLPNTDGMEMLLCYEDEGVYVNTYGRIIKDVVLQWGEMPTSVAY   1191 - 1260
ICSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFASVRSGGSSQVYFMTLNRNCIM   1261 - 1330
NW                                                                       1331 - 1332
//

Text Mined References (42)

PMID Year Title
26496226 2015 Immediate-early response 5 (IER5) interacts with protein phosphatase 2A and regulates the phosphorylation of ribosomal protein S6 kinase and heat shock factor 1.
25816751 2015 HSF1 transcriptional activity is modulated by IER5 and PP2A/B55.
25747578 2015 The role of Misshapen NCK-related kinase (MINK), a novel Ste20 family kinase, in the IRES-mediated protein translation of human enterovirus 71.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
22665485 2012 Misshapen-like kinase 1 (MINK1) is a novel component of striatin-interacting phosphatase and kinase (STRIPAK) and is required for the completion of cytokinesis.
22037766 2012 Mink1 regulates ?-catenin-independent Wnt signaling via Prickle phosphorylation.
21690388 2011 Smad inhibition by the Ste20 kinase Misshapen.
More...