Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.19
PubTator Score 1.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
intraductal papillary-mucinous adenoma (IPMA) 2956 2.51988528725332E-5
Endometriosis 535 0.00723559014278876
active Crohn's disease 918 0.018505185563975
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0385264902913103

Expression

Synonym

Accession Q8N4C7
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

AA Sequence

MKDRLQELKQRTKEIELSRDSHVSTTETEEQGVFLQQAVIYEREPVAERHLHEIQKLQESINNLADNVQK      1 - 70
FGQQQKSLVASMRRFSLLKRESTITKEIKIQAEYINRSLNDLVKEVKKSEVENGPSSVVTRILKSQHAAM     71 - 140
FRHFQQIMFIYNDTIAAKQEKCKTFILRQLEVAGKEMSEEDVNDMLHQGKWEVFNESLLTEINITKAQLS    141 - 210
EIEQRHKELVNLENQIKDLRDLFIQISLLVEEQGESINNIEMTVNSTKEYVNNTKEKFGLAVKYKKRNPC    211 - 280
RVLCCWCCPCCSSK                                                            281 - 294
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
20545907 2010 A targeted siRNA screen to identify SNAREs required for constitutive secretion in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.