Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.19
PubTator Score 1.07

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N4C7
Symbols

Gene

AA Sequence

MKDRLQELKQRTKEIELSRDSHVSTTETEEQGVFLQQAVIYEREPVAERHLHEIQKLQESINNLADNVQK      1 - 70
FGQQQKSLVASMRRFSLLKRESTITKEIKIQAEYINRSLNDLVKEVKKSEVENGPSSVVTRILKSQHAAM     71 - 140
FRHFQQIMFIYNDTIAAKQEKCKTFILRQLEVAGKEMSEEDVNDMLHQGKWEVFNESLLTEINITKAQLS    141 - 210
EIEQRHKELVNLENQIKDLRDLFIQISLLVEEQGESINNIEMTVNSTKEYVNNTKEKFGLAVKYKKRNPC    211 - 280
RVLCCWCCPCCSSK                                                            281 - 294
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
20545907 2010 A targeted siRNA screen to identify SNAREs required for constitutive secretion in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.