Property Summary

NCBI Gene PubMed Count 43
Grant Count 18
R01 Count 5
Funding $3,425,297.66
PubMed Score 420.09
PubTator Score 192.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
25741725 Ninein influences the rate of axonal growth and branching by affecting microtubule stability and dynamics.
25332239 JAK2 Tyrosine Kinase phosphorylates centrosomal protein ninein, which negatively regulates it
23665482 A Ninein (NIN) missense mutation identified in a family with spondyloepimetaphyseal dysplasia with joint laxity (leptodactylic type)-like phenotype.
23047184 The role of hNinein isoform 6 expression in cell differentiation was assessed in BrdU-treated IMR-32 cells
22937743 Our analyses suggest a relationship with prenatal neurogenesis and identify the human data point as an outlier, possibly explained by postnatal changes in development on the human lineage.
21667027 The prevalence of hNinein autoreactivity and its specificity in 22 rheumatoid arthritis and 32 systemic lupus erythematosus autoimmune disease sera.
21325031 Trichoplein controls microtubule anchoring at the centrosome by binding to Odf2 and ninein.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MDEVEQDQHEARLKELFDSFDTTGTGSLGQEELTDLCHMLSLEEVAPVLQQTLLQDNLLGRVHFDQFKEA      1 - 70
LILILSRTLSNEEHFQEPDCSLEAQPKYVRGGKRYGRRSLPEFQESVEEFPEVTVIEPLDEEARPSHIPA     71 - 140
GDCSEHWKTQRSEEYEAEGQLRFWNPDDLNASQSGSSPPQDWIEEKLQEVCEDLGITRDGHLNRKKLVSI    141 - 210
CEQYGLQNVDGEMLEEVFHNLDPDGTMSVEDFFYGLFKNGKSLTPSASTPYRQLKRHLSMQSFDESGRRT    211 - 280
TTSSAMTSTIGFRVFSCLDDGMGHASVERILDTWQEEGIENSQEILKALDFSLDGNINLTELTLALENEL    281 - 350
LVTKNSIHQAALASFKAEIRHLLERVDQVVREKEKLRSDLDKAEKLKSLMASEVDDHHAAIERRNEYNLR    351 - 420
KLDEEYKERIAALKNELRKEREQILQQAGKQRLELEQEIEKAKTEENYIRDRLALSLKENSRLENELLEN    421 - 490
AEKLAEYENLTNKLQRNLENVLAEKFGDLDPSSAEFFLQEERLTQMRNEYERQCRVLQDQVDELQSELEE    491 - 560
YRAQGRVLRLPLKNSPSEEVEANSGGIEPEHGLGSEECNPLNMSIEAELVIEQMKEQHHRDICCLRLELE    561 - 630
DKVRHYEKQLDETVVSCKKAQENMKQRHENETHTLEKQISDLKNEIAELQGQAAVLKEAHHEATCRHEEE    631 - 700
KKQLQVKLEEEKTHLQEKLRLQHEMELKARLTQAQASFEREREGLQSSAWTEEKVRGLTQELEQFHQEQL    701 - 770
TSLVEKHTLEKEELRKELLEKHQRELQEGREKMETECNRRTSQIEAQFQSDCQKVTERCESALQSLEGRY    771 - 840
RQELKDLQEQQREEKSQWEFEKDELTQECAEAQELLKETLKREKTTSLVLTQEREMLEKTYKEHLNSMVV    841 - 910
ERQQLLQDLEDLRNVSETQQSLLSDQILELKSSHKRELREREEVLCQAGASEQLASQRLERLEMEHDQER    911 - 980
QEMMSKLLAMENIHKATCETADRERAEMSTEISRLQSKIKEMQQATSPLSMLQSGCQVIGEEEVEGDGAL    981 - 1050
SLLQQGEQLLEENGDVLLSLQRAHEQAVKENVKMATEISRLQQRLQKLEPGLVMSSCLDEPATEFFGNTA   1051 - 1120
EQTEQFLQQNRTKQVEGVTRRHVLSDLEDDEVRDLGSTGTSSVQRQEVKIEESEASVEGFSELENSEETR   1121 - 1190
TESWELKNQISQLQEQLMMLCADCDRASEKKQDLLFDVSVLKKKLKMLERIPEASPKYKLLYEDVSREND   1191 - 1260
CLQEELRMMETRYDEALENNKELTAEVFRLQDELKKMEEVTETFLSLEKSYDEVKIENEGLNVLVLRLQG   1261 - 1330
KIEKLQESVVQRCDCCLWEASLENLEIEPDGNILQLNQTLEECVPRVRSVHHVIEECKQENQYLEGNTQL   1331 - 1400
LEKVKAHEIAWLHGTIQTHQERPRVQNQVILEENTTLLGFQDKHFQHQATIAELELEKTKLQELTRKLKE   1401 - 1470
RVTILVKQKDVLSHGEKEEELKAMMHDLQITCSEMQQKVELLRYESEKLQQENSILRNEITTLNEEDSIS   1471 - 1540
NLKLGTLNGSQEEMWQKTETVKQENAAVQKMVENLKKQISELKIKNQQLDLENTELSQKNSQNQEKLQEL   1541 - 1610
NQRLTEMLCQKEKEPGNSALEEREQEKFNLKEELERCKVQSSTLVSSLEAELSEVKIQTHIVQQENHLLK   1611 - 1680
DELEKMKQLHRCPDLSDFQQKISSVLSYNEKLLKEKEALSEELNSCVDKLAKSSLLEHRIATMKQEQKSW   1681 - 1750
EHQSASLKSQLVASQEKVQNLEDTVQNVNLQMSRMKSDLRVTQQEKEALKQEVMSLHKQLQNAGGKSWAP   1751 - 1820
EIATHPSGLHNQQKRLSWDKLDHLMNEEQQLLWQENERLQTMVQNTKAELTHSREKVRQLESNLLPKHQK   1821 - 1890
HLNPSGTMNPTEQEKLSLKRECDQFQKEQSPANRKVSQMNSLEQELETIHLENEGLKKKQVKLDEQLMEM   1891 - 1960
QHLRSTATPSPSPHAWDLQLLQQQACPMVPREQFLQLQRQLLQAERINQHLQEELENRTSETNTPQGNQE   1961 - 2030
QLVTVMEERMIEVEQKLKLVKRLLQEKVNQLKEQVSLPGHLCSPTSHSSFNSSFTSLYCH             2031 - 2090
//

Text Mined References (48)

PMID Year Title
25741725 2015 Sip1 downstream Effector ninein controls neocortical axonal growth, ipsilateral branching, and microtubule growth and stability.
25332239 2015 JAK2 tyrosine kinase phosphorylates and is negatively regulated by centrosomal protein Ninein.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
23665482 Identification of a Ninein (NIN) mutation in a family with spondyloepimetaphyseal dysplasia with joint laxity (leptodactylic type)-like phenotype.
23386061 2013 Kif3a interacts with Dynactin subunit p150 Glued to organize centriole subdistal appendages.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23047184 Differential expression of centrosome-associated proteins in human brain tumors: a possible role of hNinein isoform 6 in cell differentiation.
22937743 2012 Positive selection on NIN, a gene involved in neurogenesis, and primate brain evolution.
22933543 2012 Novel microcephalic primordial dwarfism disorder associated with variants in the centrosomal protein ninein.
More...