Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MGLSPGQTSVSFLWPLLEVRDHNTGRGLVPATVLTPGSPETLLELRQAFLGSRQARHGHDAAPSSGQQGC      1 - 70
SVDRTAGRPVLGWRLRNSLTGQEGRQHLHLSGIRTSRKAKEYKPVFFGATEISVLMAVAESLREPPPPQW     71 - 140
GWFLSSLFLKIF                                                              141 - 152
//

Text Mined References (3)

PMID Year Title