Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.37
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 7.16748531394337E-9
oligodendroglioma 2849 2.666736650647E-7
sonic hedgehog group medulloblastoma 1482 1.36510572287743E-5
atypical teratoid/rhabdoid tumor 1095 4.27133742453489E-5
pediatric high grade glioma 2712 7.60377897287104E-5
medulloblastoma, large-cell 6234 1.9126341603559E-4
psoriasis 6685 2.63168501270894E-4
posterior fossa group A ependymoma 1511 2.72190386469279E-4
pituitary cancer 1972 5.96507144467907E-4
glioblastoma 5572 6.19557507657123E-4
primitive neuroectodermal tumor 3031 0.00383707834672449
subependymal giant cell astrocytoma 2287 0.00460180601653558
chronic rhinosinusitis 512 0.0136516462346733
Pick disease 1893 0.0150574637169959
pilocytic astrocytoma 3086 0.0295788720655607

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -1.300 0.000
glioblastoma -1.900 0.001
oligodendroglioma -1.400 0.000
posterior fossa group A ependymoma -1.500 0.000
sonic hedgehog group medulloblastoma -3.200 0.000
atypical teratoid/rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.900 0.004
pediatric high grade glioma -2.200 0.000
pilocytic astrocytoma -1.100 0.030
subependymal giant cell astrocytoma -4.193 0.005
Pick disease -1.300 0.015
pituitary cancer 1.800 0.001
chronic rhinosinusitis -1.453 0.014
psoriasis -1.300 0.000

AA Sequence

MPFPPMPPPPAPAPGAQAARQLPRRPCAAGDKKKRPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPP      1 - 70
APPGVSPQALPSRARAPATCAPPRPAGSGHSPARTTYAATSAGTGTTAAGTSSGAGPCPDSAARFCLNLT     71 - 140
PEAVLVIQKRHLEKQLLARPRRPFPSPSAEPRRLLAPCLPARAAGPRRGGPASDPDAPPTAGQGRRAPPP    141 - 210
GAQLLHGGLQVPQLSPRPGALRPMLKVSLLNERHRYDDVEYEEEPEAVDEGLVRKCTEWLRGVESAAAAR    211 - 280
GRAGALDSRRHLSTL                                                           281 - 295
//

Text Mined References (4)

PMID Year Title
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.