Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.37
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -1.300 0.000
glioblastoma -1.900 0.001
oligodendroglioma -1.400 0.000
posterior fossa group A ependymoma -1.500 0.000
sonic hedgehog group medulloblastoma -3.200 0.000
atypical teratoid/rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.900 0.004
pediatric high grade glioma -2.200 0.000
pilocytic astrocytoma -1.100 0.030
subependymal giant cell astrocytoma -4.193 0.005
Pick disease -1.300 0.015
pituitary cancer 1.800 0.001
chronic rhinosinusitis -1.453 0.014
psoriasis -1.300 0.000

Synonym

Accession Q8N4B5
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (1)

AA Sequence

MPFPPMPPPPAPAPGAQAARQLPRRPCAAGDKKKRPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPP      1 - 70
APPGVSPQALPSRARAPATCAPPRPAGSGHSPARTTYAATSAGTGTTAAGTSSGAGPCPDSAARFCLNLT     71 - 140
PEAVLVIQKRHLEKQLLARPRRPFPSPSAEPRRLLAPCLPARAAGPRRGGPASDPDAPPTAGQGRRAPPP    141 - 210
GAQLLHGGLQVPQLSPRPGALRPMLKVSLLNERHRYDDVEYEEEPEAVDEGLVRKCTEWLRGVESAAAAR    211 - 280
GRAGALDSRRHLSTL                                                           281 - 295
//

Text Mined References (4)

PMID Year Title
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.