Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.37
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.600 2.6e-02
astrocytoma -1.300 7.2e-09
Astrocytoma, Pilocytic -1.100 3.1e-02
atypical teratoid / rhabdoid tumor -2.100 5.5e-04
chronic rhinosinusitis -1.453 1.4e-02
ependymoma -1.300 1.1e-03
glioblastoma -1.300 4.9e-03
group 3 medulloblastoma -2.700 3.4e-03
medulloblastoma, large-cell -2.700 1.9e-04
oligodendroglioma -1.400 2.7e-07
Pick disease -1.300 1.5e-02
pituitary cancer 1.800 6.0e-04
primitive neuroectodermal tumor -1.900 3.8e-03
psoriasis -1.300 2.6e-04
subependymal giant cell astrocytoma -4.193 4.6e-03

AA Sequence

MPFPPMPPPPAPAPGAQAARQLPRRPCAAGDKKKRPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPP      1 - 70
APPGVSPQALPSRARAPATCAPPRPAGSGHSPARTTYAATSAGTGTTAAGTSSGAGPCPDSAARFCLNLT     71 - 140
PEAVLVIQKRHLEKQLLARPRRPFPSPSAEPRRLLAPCLPARAAGPRRGGPASDPDAPPTAGQGRRAPPP    141 - 210
GAQLLHGGLQVPQLSPRPGALRPMLKVSLLNERHRYDDVEYEEEPEAVDEGLVRKCTEWLRGVESAAAAR    211 - 280
GRAGALDSRRHLSTL                                                           281 - 295
//

Text Mined References (4)

PMID Year Title