Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.65
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
24377578 FBXO39 showed significant up-regulation in invasive ductal breast carcinoma.
21338577 These data suggest that the BCP-20 (FBXO39) gene is a new Cancer/Testis antigen and may be useful for diagnosis and immunotherapy.

AA Sequence

MDEESELIQPQDQSCWAFLPDLCLCRVFWWLGDRDRSRAALVCRKWNQMMYSAELWRYRTITFSGRPSRV      1 - 70
HASEVESAVWYVKKFGRYLEHLEVKFMNPYNAVLTKKFQVTMRGLLSCLSKSNNRLKSLSIQYLELDRLV     71 - 140
WRNSIRSSFISSLSFFLKKMGKRLDYLNLKGARLTVEQGCQILDSLSYMRNENVISELNIEDYFSHHLAV    141 - 210
YNSPQFKKTMSTFHNLVSLNLNYNCISDELLENLCENASTLRTINIKCHVHDPHGQVIWGMSWAKLARQA    211 - 280
TNLKVNFFFERIMKYERLARILLQEIPIRSISLRSCYFSDPDCSMRPTLIDLLPTFRHTLQKLTCEFNNN    281 - 350
HESLDEELHLLIISCRKLFYFKIWAFLDVSFVERILKSQKERQCALRVFKARIYTNRYETNEEDKTLQEI    351 - 420
YRKYRKLIESELSYFVIVYSVM                                                    421 - 442
//

Text Mined References (6)

PMID Year Title
24816252 2014 An atlas of genetic influences on human blood metabolites.
24377578 2014 Expression analysis of two cancer-testis genes, FBXO39 and TDRD4, in breast cancer tissues and cell lines.
21338577 2011 Identification of BCP-20 (FBXO39) as a cancer/testis antigen from colon cancer patients by SEREX.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.