Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.18
PubTator Score 0.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Dent disease 20 4.021 2.0

Expression

Synonym

Accession Q8N4B1 J3KP50 Q6PJL9 Q96MH8 Ses1
Symbols SES1
IPIP27A

Gene

PDB

3QIS  

Gene RIF (2)

PMID Text
21233288 Two novel OCRL1-binding proteins, termed inositol polyphosphate phosphatase interacting protein of 27 kDa (IPIP27)A and B (also known as Ses1 and 2), that also bind the related 5-phosphatase Inpp5b, were identified.
20133602 Two closely related endocytic proteins, Ses1 and Ses2, which interact with OCRL, were identified. The interaction is mediated by a short amino acid motif similar to that used by the rab-5 effector APPL1.

AA Sequence

MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVEL      1 - 70
VEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQ     71 - 140
PQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRR    141 - 210
RASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP                                   211 - 249
//

Text Mined References (10)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21666675 2011 Recognition of the F&H motif by the Lowe syndrome protein OCRL.
21233288 2011 The PH domain proteins IPIP27A and B link OCRL1 to receptor recycling in the endocytic pathway.
20133602 2010 Two closely related endocytic proteins that share a common OCRL-binding motif with APPL1.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.