Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.18
PubTator Score 0.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count Z-score Confidence
Oculocerebrorenal syndrome 29 4.995 2.5
Dent disease 18 3.922 2.0

Expression

Gene RIF (2)

AA Sequence

MKLNERSLAFYATCDAPVDNAGFLYKKGGRHAAYHRRWFVLRGNMLFYFEDAASREPVGVIILEGCTVEL      1 - 70
VEAAEEFAFAVRFAGTRARTYVLAAESQDAMEGWVKALSRASFDYLRLVVRELEQQLAAVRGGGGMALPQ     71 - 140
PQPQSLPLPPSLPSALAPVPSLPSAPAPVPALPLPRRPSALPPKENGCAVWSTEATFRPGPEPPPPPPRR    141 - 210
RASAPHGPLDMAPFARLHECYGQEIRALRGQWLSSRVQP                                   211 - 249
//

Text Mined References (10)

PMID Year Title