Property Summary

NCBI Gene PubMed Count 9
PubMed Score 201.63
PubTator Score 9.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.400 2.9e-02
Astrocytoma, Pilocytic -2.400 1.3e-06
atypical teratoid / rhabdoid tumor -1.800 1.3e-02
glioblastoma -2.100 4.5e-02
group 3 medulloblastoma -4.100 1.7e-07
lung carcinoma 1.300 8.5e-07
medulloblastoma, large-cell -4.200 5.8e-06
osteosarcoma -1.105 7.9e-05
ovarian cancer 1.700 1.4e-02
pediatric high grade glioma -1.800 1.9e-02
posterior fossa group A ependymoma 1.300 1.3e-04
psoriasis -1.200 1.2e-09

Gene RIF (3)

AA Sequence

MDRTLESLRHIIAQVLPHRDPALVFKDLNVVSMLQEFWESKQQQKAAFPSEGVVVYESLPAPGPPFVSYV      1 - 70
TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMESVQEAVASTSGTLDDADDPST     71 - 140
SVGAYHYMLESNMGKTMLEFQELMTIFQLLHWNGSLKALRETKCSRQEVISYYSQYSLDEKMRSHMALDW    141 - 210
IMKERDSPGIVSQELRMALRQLEEARKAGQELRFYKEKKEILSLALTQICSDPDTSSPSDDQLSLTALCG    211 - 280
YH                                                                        281 - 282
//

Text Mined References (9)

PMID Year Title