Property Summary

NCBI Gene PubMed Count 9
Grant Count 12
R01 Count 5
Funding $930,035.68
PubMed Score 195.27
PubTator Score 9.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.400 0.029
osteosarcoma -1.105 0.000
sonic hedgehog group medulloblastoma -4.600 0.000
atypical teratoid / rhabdoid tumor -1.800 0.013
glioblastoma -2.100 0.045
medulloblastoma, large-cell -4.200 0.000
pediatric high grade glioma -1.800 0.019
pilocytic astrocytoma -2.400 0.000
posterior fossa group A ependymoma 1.300 0.000
lung carcinoma 1.300 0.000
ovarian cancer 1.700 0.014
psoriasis -1.200 0.000

Gene RIF (3)

PMID Text
19834535 Observational study of gene-disease association. (HuGE Navigator)
19664890 Observational study of gene-disease association. (HuGE Navigator)
18395445 Data show that mutations in LIX1 do not contribute significantly to the cause of motor neuron diseases in the human population.

AA Sequence

MDRTLESLRHIIAQVLPHRDPALVFKDLNVVSMLQEFWESKQQQKAAFPSEGVVVYESLPAPGPPFVSYV      1 - 70
TLPGGSCFGNFQCCLSRAEARRDAAKVALINSLFNELPSRRITKEFIMESVQEAVASTSGTLDDADDPST     71 - 140
SVGAYHYMLESNMGKTMLEFQELMTIFQLLHWNGSLKALRETKCSRQEVISYYSQYSLDEKMRSHMALDW    141 - 210
IMKERDSPGIVSQELRMALRQLEEARKAGQELRFYKEKKEILSLALTQICSDPDTSSPSDDQLSLTALCG    211 - 280
YH                                                                        281 - 282
//

Text Mined References (9)

PMID Year Title
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19710173 2009 Drosophila lowfat, a novel modulator of Fat signaling.
19664890 2010 Screening of the LIX1 gene in Japanese and Malaysian patients with SMA and/or SMA-like disorder.
18395445 2008 Candidate screening of the bovine and feline spinal muscular atrophy genes reveals no evidence for involvement in human motor neuron disorders.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12638132 2002 Murine Lix1, a novel marker for substantia nigra, cortical layer 5, and hindbrain structures.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11731258 2001 Cloning and expression analysis of chicken Lix1, a founding member of a novel gene family.