Property Summary

NCBI Gene PubMed Count 12
Grant Count 5
Funding $282,360.33
PubMed Score 6.32
PubTator Score 4.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -1.800 0.000
glioblastoma -4.600 0.000
oligodendroglioma -2.000 0.000
ependymoma -1.800 0.015
atypical teratoid / rhabdoid tumor -3.000 0.005
adult high grade glioma -5.000 0.000
pilocytic astrocytoma -4.700 0.000
sonic hedgehog group medulloblastoma -3.400 0.000
non primary Sjogren syndrome sicca -1.200 0.023
subependymal giant cell astrocytoma -4.734 0.012

Gene RIF (3)

PMID Text
26045876 FSTL5 plays a suppressive role in hepatocellular carcinoma. Down-regulation of FSTL5 could promote growth and survival of HCC cells by activation of Wnt/beta-catenin signaling.
21911727 FSTL5 expression denoted a dismal prognosis both within and across medulloblastoma subgroups.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MFKCWSVVLVLGFIFLESEGRPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDGPFGSCENKYC      1 - 70
GLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACLKKQKITIVHNEDCFFKGDKC     71 - 140
KTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLVDQMFKYFDADSNGLVDINELTQVIKQEELG    141 - 210
KDLFDCTLYVLLKYDDFNADKHLALEEFYRAFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPI    211 - 280
IWKRNNIILNNLDLEDINDFGDDGSLYITKVTTTHVGNYTCYADGYEQVYQTHIFQVNVPPVIRVYPESQ    281 - 350
AREPGVTASLRCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG    351 - 420
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSEKLLGFQDEVC    421 - 490
PKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLS    491 - 560
WGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQFDRVDDFFIPTTTLIITHMRFGFILHKDEAALQKID    561 - 630
LETMSYIKTINLKDYKCVPQSLAYTHLGGYYFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVS    631 - 700
PDGHYLVSINDVKGLVRVQYITIRGEIQEAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVE    701 - 770
LSSGKVKMIKSLKEPLKAEEWPWNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNT    771 - 840
VIWVGDA                                                                   841 - 847
//

Text Mined References (16)

PMID Year Title
26045876 2015 Down-regulated FSTL5 promotes cell proliferation and survival by affecting Wnt/?-catenin signaling in hepatocellular carcinoma.
25023989 2014 A novel colorectal cancer risk locus at 4q32.2 identified from an international genome-wide association study.
24407287 2014 Promyelocytic leukemia protein interacts with the apoptosis-associated speck-like protein to limit inflammasome activation.
21911727 2011 FSTL5 is a marker of poor prognosis in non-WNT/non-SHH medulloblastoma.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...