Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.32
PubTator Score 4.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -5.000 1.6e-07
astrocytoma -1.800 1.8e-08
Astrocytoma, Pilocytic -4.700 3.2e-09
atypical teratoid / rhabdoid tumor -3.000 5.4e-03
ependymoma -1.800 1.5e-02
glioblastoma -4.300 1.5e-09
non primary Sjogren syndrome sicca -1.200 2.3e-02
oligodendroglioma -2.000 1.0e-08
sonic hedgehog group medulloblastoma -3.400 3.4e-05
subependymal giant cell astrocytoma -4.734 1.2e-02

 GO Function (1)

 GO Component (1)

Gene RIF (3)

AA Sequence

MFKCWSVVLVLGFIFLESEGRPTKEGGYGLKSYQPLMRLRHKQEKNQESSRVKGFMIQDGPFGSCENKYC      1 - 70
GLGRHCVTSRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVHRAACLKKQKITIVHNEDCFFKGDKC     71 - 140
KTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISRKKLLVDQMFKYFDADSNGLVDINELTQVIKQEELG    141 - 210
KDLFDCTLYVLLKYDDFNADKHLALEEFYRAFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPI    211 - 280
IWKRNNIILNNLDLEDINDFGDDGSLYITKVTTTHVGNYTCYADGYEQVYQTHIFQVNVPPVIRVYPESQ    281 - 350
AREPGVTASLRCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIAKNEAG    351 - 420
VDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSEKLLGFQDEVC    421 - 490
PKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLS    491 - 560
WGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQFDRVDDFFIPTTTLIITHMRFGFILHKDEAALQKID    561 - 630
LETMSYIKTINLKDYKCVPQSLAYTHLGGYYFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVS    631 - 700
PDGHYLVSINDVKGLVRVQYITIRGEIQEAFDIYTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVE    701 - 770
LSSGKVKMIKSLKEPLKAEEWPWNRKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNT    771 - 840
VIWVGDA                                                                   841 - 847
//

Text Mined References (16)

PMID Year Title