Property Summary

Ligand Count 68
NCBI Gene PubMed Count 169
PubMed Score 279.53
PubTator Score 316.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (28)

Disease log2 FC p
aldosterone-producing adenoma -1.059 4.1e-02
astrocytic glioma -1.100 3.2e-03
Astrocytoma, Pilocytic -1.200 1.9e-02
atypical teratoid / rhabdoid tumor 1.700 2.4e-02
autosomal dominant Emery-Dreifuss muscul... 1.015 2.7e-02
Breast cancer -5.100 7.3e-27
breast carcinoma -3.000 3.1e-05
chronic rhinosinusitis -1.829 1.5e-02
colon cancer -2.000 1.3e-02
cystic fibrosis 3.846 1.3e-07
Down syndrome 2.200 6.6e-04
ductal carcinoma in situ -1.800 2.6e-02
ependymoma -1.500 1.0e-03
glioblastoma -1.200 3.6e-02
interstitial cystitis 1.400 6.6e-03
intraductal papillary-mucinous adenoma (... -1.200 2.6e-03
intraductal papillary-mucinous carcinoma... -1.100 4.7e-03
intraductal papillary-mucinous neoplasm ... -1.300 1.7e-02
invasive ductal carcinoma -3.283 6.3e-05
lung cancer -2.000 1.4e-04
malignant mesothelioma 1.200 1.2e-02
medulloblastoma 2.000 1.8e-02
ovarian cancer -3.600 2.6e-14
Pick disease -1.100 4.4e-02
primitive neuroectodermal tumor 1.600 1.6e-02
psoriasis -1.400 1.1e-05
subependymal giant cell astrocytoma -2.319 2.2e-02
ulcerative colitis -1.084 3.5e-02

Protein-protein Interaction (1)

Gene RIF (146)

AA Sequence

MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHN      1 - 70
VGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSC     71 - 140
EPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALR    141 - 210
MKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYL    211 - 280
LTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK                                        281 - 314
//

Text Mined References (169)

PMID Year Title