Property Summary

NCBI Gene PubMed Count 153
Grant Count 65
R01 Count 38
Funding $10,675,844.12
PubMed Score 259.67
PubTator Score 316.93

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8N474 O00546 O14779 FRP-1
Symbols FRP
FRP1
FrzA
FRP-1
SARP2

Gene

Gene RIF (133)

PMID Text
26851021 Hepatocellular carcinoma patients with high SFRP1 expression in tumor tissue had a significantly better overall survival rate.
26643984 Results show that SNPs rs4736958 and rs7832767 of SFRP1 gene were significantly associated with tuberculosis susceptibility and might influence the expression levels of inflammatory markers of tuberculosis patients in a Chinese Han population.
26482433 Hypermethylation of the selected markers (MAL, PRIMA1, PTGDR and SFRP1) can result in reduced gene expression and may contribute to the formation of colorectal cancer.
26413870 The increased placental expression of sFRP1 seen in smokers impairs fetal growth by inhibiting WNT signaling and trophoblast proliferation.
26397159 Down-regulation of SFRP1 is associated with recurrence in Endometrioid Adenocarcinoma.
26337424 in gliomas there was correlation of SFRP1 methylation with tumor grade and patients' survival
26276746 SFRP1 downregulation may result from epigenetic silencing and is associated with worse survival in nasopharyngeal carcinoma
26164457 SFRP1 is a direct target of MiR-27a in the regulation of glioma invasion and cell migration.
25809273 In human mammary epithelial cells with either SFRP1 knocked down (TERT-siSFRP1) and rescued SFRP1 expression (MCF7-SFRP1), estrogen signaling is augmented.
25788689 Sfrp1 contributes to coordination of visual axon growth in retinal ganglion cells.
More...

AA Sequence

MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHN      1 - 70
VGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSC     71 - 140
EPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALR    141 - 210
MKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYL    211 - 280
LTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK                                        281 - 314
//

Text Mined References (154)

PMID Year Title
26851021 2016 Loss of SFRP1 Expression Is Associated with Poor Prognosis in Hepatocellular Carcinoma.
26643984 2016 SFRP1 variations influence susceptibility and immune response to Mycobacterium tuberculosis in a Chinese Han population.
26482433 2015 DNA hypermethylation and decreased mRNA expression of MAL, PRIMA1, PTGDR and SFRP1 in colorectal adenoma and cancer.
26413870 2015 Excess placental secreted frizzled-related protein 1 in maternal smokers impairs fetal growth.
26397159 2016 Expression Patterns of the Wnt Pathway Inhibitors Dickkopf3 and Secreted Frizzled-Related Proteins 1 and 4 in Endometrial Endometrioid Adenocarcinoma: An NRG Oncology/Gynecologic Oncology Group Study.
26337424 2016 Wnt pathway antagonists, SFRP1, SFRP2, SOX17, and PPP2R2B, are methylated in gliomas and SFRP1 methylation predicts shorter survival.
26276746 2015 Low SFRP1 Expression Correlates with Poor Prognosis and Promotes Cell Invasion by Activating the Wnt/?-Catenin Signaling Pathway in NPC.
26164457 2015 MiR-27a regulates Wnt/beta-catenin signaling through targeting SFRP1 in glioma.
25809273 2015 Estrogen-mediated signaling is differentially affected by the expression levels of Sfrp1 in mammary epithelial cells.
25788689 2015 Secreted frizzled related proteins modulate pathfinding and fasciculation of mouse retina ganglion cell axons by direct and indirect mechanisms.
More...