Property Summary

NCBI Gene PubMed Count 19
PubMed Score 8.53
PubTator Score 17.03

Knowledge Summary


No data available


  Disease Sources (4)


  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.097 0.002
medulloblastoma, large-cell -1.100 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.018
ovarian cancer -1.500 0.000
Breast cancer -1.100 0.000


Accession Q8N465 B4E3L6 E7ENP2 Q6IQ24 Q8N5Q8
Symbols D2HGD


PANTHER Protein Class (2)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG
S.cerevisiae OMA Inparanoid

Gene RIF (6)

26178471 D2HGDH elevates alpha-KG levels via IDH2 expression modulation, influencing histone and DNA methylation, and HIF1alpha hydroxylation. D2HGDH mutants found in diffuse large B-cell lymphoma are enzymatically inert.
21625441 D2HGDH mutation is not associated with glioblastoma.
20727073 We did not find evidence for mutations in the genes D2HGDH and L2HGDH as an alternative mechanism for raised 2-hydroxyglutarate levels in brain tumours
20727073 Observational study of gene-disease association. (HuGE Navigator)
19283509 This enzyme assay will have utility in differentiating patients with 2-hydroxyglutaric aciduria and in assessing the residual activities linked to pathogenic mutations in the D2HGDH gene
16037974 Two novel pathogenic mutations in D-2-hydroxyglutarate dehydrogenase gene in patient with a mild presentation and asymptomatic siblings with D-2-hydroxyglutaric aciduria with a splice error (IVS4-2A-->G) and a missense mutation (c.1315A-->G;p.Asn439Asp).

AA Sequence

PPGALQLMQQLKALLDPKGILNPYKTLPSQA                                           491 - 521

Text Mined References (18)

PMID Year Title
26178471 2015 D2HGDH regulates alpha-ketoglutarate levels and dioxygenase function by modulating IDH2.
21625441 2011 Screen for IDH1, IDH2, IDH3, D2HGDH and L2HGDH mutations in glioblastoma.
20727073 2011 Mutational analysis of D2HGDH and L2HGDH in brain tumours without IDH1 or IDH2 mutations.
19283509 2009 Measurement of D: -2-hydroxyglutarate dehydrogenase activity in cell homogenates derived from D: -2-hydroxyglutaric aciduria patients.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16442322 2006 D-2-hydroxyglutaric aciduria in three patients with proven SSADH deficiency: genetic coincidence or a related biochemical epiphenomenon?
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16081310 Phenotypic heterogeneity in the presentation of D-2-hydroxyglutaric aciduria in monozygotic twins.
16037974 2005 Mutations in phenotypically mild D-2-hydroxyglutaric aciduria.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.