Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.81
PubTator Score 17.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.100 7.7e-05
intraductal papillary-mucinous adenoma (... 1.100 1.8e-02
medulloblastoma, large-cell -1.100 4.2e-04
osteosarcoma -1.097 1.5e-03
ovarian cancer -1.500 4.2e-06

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MLPRRPLAWPAWLLRGAPGAAGSWGRPVGPLARRGCCSAPGTPEVPLTRERYPVRRLPFSTVSKQDLAAF      1 - 70
ERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSV     71 - 140
PVFDEIILSTARMNRVLSFHSVSGILVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGG    141 - 210
LRFLRYGSLHGTVLGLEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVN    211 - 280
VAFLGCPGFAEVLQTFSTCKGMLGEILSAFEFMDAVCMQLVGRHLHLASPVQESPFYVLIETSGSNAGHD    281 - 350
AEKLGHFLEHALGSGLVTDGTMATDQRKVKMLWALRERITEALSRDGYVYKYDLSLPVERLYDIVTDLRA    351 - 420
RLGPHAKHVVGYGHLGDGNLHLNVTAEAFSPSLLAALEPHVYEWTAGQQGSVSAEHGVGFRKRDVLGYSK    421 - 490
PPGALQLMQQLKALLDPKGILNPYKTLPSQA                                           491 - 521
//

Text Mined References (19)

PMID Year Title