Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.68
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.100 0.007
astrocytoma -1.900 0.000
ependymoma -4.300 0.000
oligodendroglioma -1.900 0.000
glioblastoma -3.600 0.000
medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -5.200 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -2.800 0.002
tuberculosis 1.900 0.000
breast carcinoma 1.200 0.034
pediatric high grade glioma -3.000 0.000
pilocytic astrocytoma -2.400 0.000
Pick disease -1.400 0.000
invasive ductal carcinoma 3.000 0.014

Gene RIF (1)

PMID Text
20043084 the expression of FBXL16 reproducibly upregulated in p16INK4A and p14ARF knockdown HeLa cells

AA Sequence

MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPATKNRPCQPPPPPTLPPPSLAAPLSRAALA      1 - 70
GGPCTPAGGPASALAPGHPAERPPLATDEKILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPV     71 - 140
LHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKAMSLKRSTITDAGL    141 - 210
EVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHV    211 - 280
TDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRS    281 - 350
LDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLA    351 - 420
LGSLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE               421 - 479
//

Text Mined References (7)

PMID Year Title
20043084 2010 FBXL16 is a novel E2F1-regulated gene commonly upregulated in p16INK4A- and p14ARF-silenced HeLa cells.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.