Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.68
PubTator Score 1.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 4.63785952540602E-20
oligodendroglioma 2849 1.08154577672612E-17
astrocytoma 1493 9.47530595499485E-15
atypical teratoid / rhabdoid tumor 4369 9.07297907575783E-11
pilocytic astrocytoma 3086 3.73358529587371E-10
medulloblastoma 1524 4.24380949911304E-9
pediatric high grade glioma 2712 5.09661938895535E-7
medulloblastoma, large-cell 6234 1.38657584819304E-6
tuberculosis 1563 2.79189551967651E-6
glioblastoma 5572 7.93019698181953E-6
Pick disease 1893 8.61490813100139E-5
primitive neuroectodermal tumor 3031 0.0024105950177436
gastric cancer 436 0.00723615220145581
invasive ductal carcinoma 2950 0.0135712290197427
breast carcinoma 1614 0.0340045556353624

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.100 0.007
astrocytoma -1.900 0.000
ependymoma -4.300 0.000
oligodendroglioma -1.900 0.000
glioblastoma -3.600 0.000
medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -5.200 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -2.800 0.002
tuberculosis 1.900 0.000
breast carcinoma 1.200 0.034
pediatric high grade glioma -3.000 0.000
pilocytic astrocytoma -2.400 0.000
Pick disease -1.400 0.000
invasive ductal carcinoma 3.000 0.014

Synonym

Accession Q8N461 B3KR59 D3DU60 Q2MHR2 Q96S14 Q9UJI0
Symbols Fbl16
C16orf22
c380A1.1

Gene

  Ortholog (9)

Species Source
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20043084 the expression of FBXL16 reproducibly upregulated in p16INK4A and p14ARF knockdown HeLa cells

AA Sequence

MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPATKNRPCQPPPPPTLPPPSLAAPLSRAALA      1 - 70
GGPCTPAGGPASALAPGHPAERPPLATDEKILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPV     71 - 140
LHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKAMSLKRSTITDAGL    141 - 210
EVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHV    211 - 280
TDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRS    281 - 350
LDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLA    351 - 420
LGSLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE               421 - 479
//

Text Mined References (7)

PMID Year Title
20043084 2010 FBXL16 is a novel E2F1-regulated gene commonly upregulated in p16INK4A- and p14ARF-silenced HeLa cells.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.