Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.67
PubTator Score 1.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.900 4.8e-07
astrocytic glioma -1.600 2.1e-02
Astrocytoma, Pilocytic -2.300 4.5e-10
atypical teratoid / rhabdoid tumor -5.200 9.1e-11
breast carcinoma 1.200 3.4e-02
ependymoma -3.600 1.6e-02
gastric cancer 1.100 7.2e-03
glioblastoma -2.700 2.0e-08
group 3 medulloblastoma -2.400 2.8e-04
invasive ductal carcinoma 3.000 1.4e-02
medulloblastoma, large-cell -3.100 1.4e-06
oligodendroglioma -1.300 3.6e-02
Pick disease -1.400 8.6e-05
primitive neuroectodermal tumor -2.800 2.4e-03
tuberculosis 1.900 2.8e-06

Protein-protein Interaction (3)

Gene RIF (1)

AA Sequence

MSSPGIDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGTPATKNRPCQPPPPPTLPPPSLAAPLSRAALA      1 - 70
GGPCTPAGGPASALAPGHPAERPPLATDEKILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPV     71 - 140
LHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKAMSLKRSTITDAGL    141 - 210
EVMLEQMQGVVRLELSGCNDFTEAGLWSSLSARITSLSVSDCINVADDAIAAISQLLPNLAELSLQAYHV    211 - 280
TDTALAYFTARQGHSTHTLRLLSCWEITNHGVVNVVHSLPNLTALSLSGCSKVTDDGVELVAENLRKLRS    281 - 350
LDLSWCPRITDMALEYVACDLHRLEELVLDRCVRITDTGLSYLSTMSSLRSLYLRWCCQVQDFGLKHLLA    351 - 420
LGSLRLLSLAGCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE               421 - 479
//

Text Mined References (8)

PMID Year Title