Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.51
PubTator Score 1.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 7.9e-18
osteosarcoma 7950 1.6e-04
sonic hedgehog group medulloblastoma 467 2.5e-02
ependymoma 4679 4.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 3.0
Systemic lupus erythematosus 194 0.0 3.0
Disease Target Count Z-score Confidence
Usher syndrome type 1 10 3.519 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.400 4.3e-02
osteosarcoma 1.243 1.6e-04
psoriasis -1.100 7.9e-18
sonic hedgehog group medulloblastoma 1.100 2.5e-02

AA Sequence

MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSIS      1 - 70
KFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVPTTL     71 - 140
GALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAAC    141 - 210
LRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSS                       211 - 261
//

Text Mined References (8)

PMID Year Title