Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 7.1e-14
ovarian cancer 8520 2.8e-11

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 4.020 7.1e-14
ovarian cancer 1.200 2.8e-11

AA Sequence

MRSLPFALTVESVSARAPTCCSTGRFTQGRQPCKCKACGRGFTQSASLLQHWRVHSDWRETLSLSPVRQD      1 - 70
LLWPLQPHQAPASPLGRSHSSAGVRQGFSGQLCCWLTKEHTLAEALRLSPVPAGFWGPVEADRPPANSHR     71 - 140
RVCPFCCCSCGDSVNEKTSLSQRVLPHPGEKTCRGGSVESVSLAPSSVAPDSTSGLRPCGSPGSFLQHLP    141 - 210
PSTLLPRPPFLYPGPPLSLQPLVPSGLPAVPAVPLGGLEVAQVPPATQPAAQQEGAMGPRSCASAGRDSR    211 - 280
EAVQAPGYPEPARKASQHRAAGPLGEARARLQRQCRAPPPPSNPHWRGALPVFPVWKASSRRSNLARH      281 - 348
//

Text Mined References (5)

PMID Year Title