Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.47
PubTator Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
posterior fossa group B ependymoma 3.100 0.000
nasopharyngeal carcinoma -1.200 0.000
chronic rhinosinusitis -1.235 0.033

Synonym

Accession Q8N443 B4E297 E9PDU2 Q5H931 Q96A80
Symbols 2610028I09Rik

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MYNIKQSTDTKEAAAIEARRNREKERQNRFFNVRNRVMGVDVQALNNQVGDRKRREAAERSKEAAYGTSQ      1 - 70
VQYDVVVQMLEKEEADRTRQLAKKVQEFREQKQQLKNGREFSLWDPGQVWKGLPTYLSYSNTYPGPASLQ     71 - 140
YFSGEDLDRDTRLRMQQGQFRYNLERQQQEQQQAKVDENYTDALSNQLRLAMDAQATHLARLEESCRAAM    141 - 210
MCAMANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPMAPYRVLPYCWKGMTPE    211 - 280
QQAAIRKEQEVQRSKKQAHRQAEKTLDTEWKSQTMSSAQAVLELEEQERELCAVFQRGLGSFNQQLANEQ    281 - 350
KAQQDYLNSVIYTNQPTAQYHQQFNTSSR                                             351 - 379
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18252223 2008 Submicroscopic duplications of the hydroxysteroid dehydrogenase HSD17B10 and the E3 ubiquitin ligase HUWE1 are associated with mental retardation.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15197164 2004 A transcript finishing initiative for closing gaps in the human transcriptome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.