Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $142,041.5
PubMed Score 120.59
PubTator Score 67.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.871 0.000
medulloblastoma, large-cell 1.100 0.014
intraductal papillary-mucinous carcinoma... 1.200 0.035
lung cancer 1.800 0.008
group 4 medulloblastoma 1.200 0.005
aldosterone-producing adenoma -1.002 0.016
lung carcinoma 1.100 0.000
Pick disease -1.300 0.000
progressive supranuclear palsy -1.100 0.005

Synonym

Accession Q8N442 Q5XKM8 Q9H710 Q9H8U4
Symbols EF4
EF-4
EIEE40

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MWTLVGRGWGCARALAPRATGAALLVAPGPRSAPTLGAAPESWATDRLYSSAEFKEKLDMSRFPVENIRN      1 - 70
FSIVAHVDHGKSTLADRLLELTGTIDKTKNNKQVLDKLQVERERGITVKAQTASLFYNCEGKQYLLNLID     71 - 140
TPGHVDFSYEVSRSLSACQGVLLVVDANEGIQAQTVANFFLAFEAQLSVIPVINKIDLKNADPERVENQI    141 - 210
EKVFDIPSDECIKISAKLGTNVESVLQAIIERIPPPKVHRKNPLRALVFDSTFDQYRGVIANVALFDGVV    211 - 280
SKGDKIVSAHTQKTYEVNEVGVLNPNEQPTHKLYAGQVGYLIAGMKDVTEAQIGDTLCLHKQPVEPLPGF    281 - 350
KSAKPMVFAGMYPLDQSEYNNLKSAIEKLTLNDSSVTVHRDSSLALGAGWRLGFLGLLHMEVFNQRLEQE    351 - 420
YNASVILTTPTVPYKAVLSSSKLIKEHREKEITIINPAQFPDKSKVTEYLEPVVLGTIITPDEYTGKIMM    421 - 490
LCEARRAVQKNMIFIDQNRVMLKYLFPLNEIVVDFYDSLKSLSSGYASFDYEDAGYQTAELVKMDILLNG    491 - 560
NTVEELVTVVHKDKAHSIGKAICERLKDSLPRQLFEIAIQAAIGSKIIARETVKAYRKNVLAKCYGGDIT    561 - 630
RKMKLLKRQAEGKKKLRKIGNVEVPKDAFIKVLKTQSSK                                   631 - 669
//

Text Mined References (11)

PMID Year Title
26486472 2016 West syndrome caused by homozygous variant in the evolutionary conserved gene encoding the mitochondrial elongation factor GUF1.
23662805 2013 The paradox of elongation factor 4: highly conserved, yet of no physiological significance?
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17203973 2007 The proteomic reactor facilitates the analysis of affinity-purified proteins by mass spectrometry: application for identifying ubiquitinated proteins in human cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8553703 1995 GUF1, a gene encoding a novel evolutionarily conserved GTPase in budding yeast.
More...