Property Summary

NCBI Gene PubMed Count 28
Grant Count 1
Funding $378,231.33
PubMed Score 34.68
PubTator Score 26.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ependymoma 1.500 0.000

Synonym

Gene

 Grant Application (1)

Gene RIF (16)

PMID Text
26025674 Cell-cell fusion induced by the Ig3 domain of receptor FGFRL1
25941324 functional evidence for a novel FGFRL1 poly-miRTS rs4647940 in a previously known 4p16.3 locus, and experimental and clinical genetics studies have shown both FGFRL1 and hsa-miR-140-5p are important for bone formation.
23775577 study identified a novel region of deletion mapping to 4p16.3 in 15 percent of bladder tumors and 24 percent of bladder cancer cell lines; FGFRL1, which maps within this region, was investigated as putative deletion target; average FGFRL1 protein expression was lower in bladder tumors compared to normal tissue, but downregulation was independent from 4p16.3 LOH status
21616146 Interaction of FGFRL1 with Spred1 increases the proportion of the receptor at the plasma membrane.
21044961 an important role for miR-210 as a tumor-suppressive microRNA with effects on cancer cell proliferation
20851884 FGFRL1 is capable of inducing syncytium formation of heterologous cells in vitro.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20184660 The signaling complex appears to integrate the input from FGFR and EphA4, and release the output signal through FRS2alpha.
20024584 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MTPSPLLLLLLPPLLLGAFPPAAAARGPPKMADKVVPRQVARLGRTVRLQCPVEGDPPPLTMWTKDGRTI      1 - 70
HSGWSRFRVLPQGLKVKQVEREDAGVYVCKATNGFGSLSVNYTLVVLDDISPGKESLGPDSSSGGQEDPA     71 - 140
SQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDITWMKDDQALTRPEAAEPRKKKWTLSLKN    141 - 210
LRPEDSGKYTCRVSNRAGAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQW    211 - 280
LKRVEYGAEGRHNSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLITRARQDDAGMYICLGANTMGYSFRS    281 - 350
AFLTVLPDPKPPGPPVASSSSATSLPWPVVIGIPAGAVFILGTLLLWLCQAQKKPCTPAPAPPLPGHRPP    351 - 420
GTARDRSGDKDLPSLAALSAGPGVGLCEEHGSPAAPQHLLGPGPVAGPKLYPKLYTDIHTHTHTHSHTHS    421 - 490
HVEGKVHQHIHYQC                                                            491 - 504
//

Text Mined References (28)

PMID Year Title
26025674 2015 Cell-cell fusion induced by the Ig3 domain of receptor FGFRL1 in CHO cells.
25941324 2015 Identification of a novel FGFRL1 MicroRNA target site polymorphism for bone mineral density in meta-analyses of genome-wide association studies.
24249740 2014 Multistage genome-wide association meta-analyses identified two new loci for bone mineral density.
23775577 2013 An integrated genomic, transcriptional and protein investigation of FGFRL1 as a putative 4p16.3 deletion target in bladder cancer.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21616146 2011 Interaction of the receptor FGFRL1 with the negative regulator Spred1.
21044961 2011 MicroRNA-210 regulates cancer cell proliferation through targeting fibroblast growth factor receptor-like 1 (FGFRL1).
20851884 2010 Rapid fusion and syncytium formation of heterologous cells upon expression of the FGFRL1 receptor.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
More...