Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.52
PubTator Score 0.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.95461697401849E-6
posterior fossa group B ependymoma 1530 4.71827371649407E-4
active ulcerative colitis 477 0.00568114141144979
chronic rhinosinusitis 512 0.0269769668638456

Expression

  Differential Expression (4)

Disease log2 FC p
active ulcerative colitis -1.607 0.006
posterior fossa group B ependymoma 1.600 0.000
ovarian cancer 1.500 0.000
chronic rhinosinusitis -1.178 0.027

Synonym

Accession Q8N434
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

AA Sequence

MATKPTEPVTILSLRKLSLGTAEPQVKEPKTFTVEDAVETIGFGRFHIALFLIMGSTGVVEAMEIMLIAV      1 - 70
VSPVIRCEWQLENWQVALVTTMVFFGYMVFSILFGLLADRYGRWKILLISFLWGAYFSLLTSFAPSYIWF     71 - 140
VFLRTMVGCGVSGHSQGLIIKTEFLPTKYRGYMLPLSQVFWLAGSLLIIGLASVIIPTIGWRWLIRVASI    141 - 210
PGIILIVAFKFIPESARFNVSTGNTRAALATLERVAKMNRSVMPEGKLVEPVLEKRGRFADLLDAKYLRT    211 - 280
TLQIWVIWLGISFAYYGVILASAELLERDLVCGSKSDSAVVVTGGDSGESQSPCYCHMFAPSDYRTMIIS    281 - 350
TIGEIALNPLNILGINFLGRRLSLSITMGCTALFFLLLNICTSSAGLIGFLFMLRALVAANFNTVYIYTA    351 - 420
EVYPTTMRALGMGTSGSLCRIGAMVAPFISQVLMSASILGALCLFSSVCVVCAISAFTLPIETKGRALQQ    421 - 490
IK                                                                        491 - 492
//

Text Mined References (4)

PMID Year Title
17714910 2007 Identification of six putative human transporters with structural similarity to the drug transporter SLC22 family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.