Property Summary

NCBI Gene PubMed Count 18
PubMed Score 10.38
PubTator Score 10.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cutaneous lupus erythematosus 2.600 0.001
osteosarcoma -5.196 0.000
tuberculosis 2.300 0.000

Synonym

Accession Q8N427 Q9NZH1
Symbols CILD6
SPTRX2
TXNDC3
NM23-H8
sptrx-2
HEL-S-99

Gene

PANTHER Protein Class (3)

Gene RIF (10)

PMID Text
25672891 GPR141-NME8 locus had strong genetic effect on the susceptibility to generalized periodontitis in Japanese individuals with history of smoking. identified 2 suggestive loci for periodontitis in a Japanese population.
25486118 NME8 locus polymorphism is associated with cognitive decline, cerebrospinal fluid and neuroimaging biomarkers in Alzheimer's disease.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237151 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
18471322 The minor allele frequencies of TXNDC3 in East Asian individuals are significantly different from those in United Kingdom control individuals.
18471322 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17360648 Primary ciliary dyskinesia is caused by an SNP-induced modification of the ratio of two physiological isoforms of TXNDC3 generated by alternative splicing.
17304710 Observational study of gene-disease association. (HuGE Navigator)
17304710 genetic association of RHOB and TXNDC3 with osteoarthritis was detected
16642435 Our approach yielded 26 candidate genes differentially expressed between patients (Osteoarthritis) and controls. The presence of allelic imbalances confirms cis-regulatory mechanisms for RHOB and TXNDC3.

AA Sequence

MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFRKLKNELNEDEILHFAVAEAD      1 - 70
NIVTLQPFRDKCEPVFLFSVNGKIIEKIQGANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVDSDS     71 - 140
EVSEESPCESVQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNFYSRIADQCDF    141 - 210
EEFVSFMTSGLSYILVVSQGSKHNPPSEETEPQTDTEPNERSEDQPEVEAQVTPGMMKNKQDSLQEYLER    211 - 280
QHLAQLCDIEEDAANVAKFMDAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQ    281 - 350
VVLSEKEAQALCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQLLGPRTVEEAIEYFPESLCAQ    351 - 420
FAMDSLPVNQLYGSDSLETAEREIQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTP    421 - 490
EQIEKIYPKVTGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFGISK    491 - 560
LKNIVHGASNAYEAKEVVNRLFEDPEEN                                              561 - 588
//

Text Mined References (19)

PMID Year Title
25672891 2015 A genome-wide association study of periodontitis in a Japanese population.
25486118 2014 Association between NME8 locus polymorphism and cognitive decline, cerebrospinal fluid and neuroimaging biomarkers in Alzheimer's disease.
24162737 2013 Meta-analysis of 74,046 individuals identifies 11 new susceptibility loci for Alzheimer's disease.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237151 2010 Field synopsis and synthesis of genetic association studies in osteoarthritis: the CUMAGAS-OSTEO information system.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
18471322 2008 Association of single-nucleotide polymorphisms in RHOB and TXNDC3 with knee osteoarthritis susceptibility: two case-control studies in East Asian populations and a meta-analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17360648 2007 A common variant in combination with a nonsense mutation in a member of the thioredoxin family causes primary ciliary dyskinesia.
More...