Property Summary

NCBI Gene PubMed Count 73
PubMed Score 77.88
PubTator Score 25.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
lung carcinoma 2844 3.57029135796564E-20
non-small cell lung cancer 2798 1.42293147179591E-13
lung adenocarcinoma 2714 1.86935925697486E-10
osteosarcoma 7933 8.92747298265336E-6
ovarian cancer 8492 3.4555796867004E-5
lung cancer 4473 4.10286508168505E-5
interstitial cystitis 2299 7.32766014613178E-5
ulcerative colitis 2087 1.61008756959397E-4
head and neck cancer and chronic obstructive pulmonary disease 237 6.09051572741387E-4
cutaneous lupus erythematosus 1056 0.00103938377639619
mucosa-associated lymphoid tissue lymphoma 480 0.0111307266102815
breast carcinoma 1614 0.0111839974636172
invasive ductal carcinoma 2950 0.0121282254322808
inflammatory breast cancer 404 0.0316580128324605

Expression

  Differential Expression (14)

Synonym

Accession Q8N423 A8MU67 C9JF29 O75017 Q8NHJ7 Q8NHJ8 LIR-2
Symbols ILT4
LIR2
CD85D
ILT-4
LIR-2
MIR10
MIR-10

Gene

PDB

2DYP   2GW5   4LLA  

Gene RIF (42)

PMID Text
27057555 in systemic lupus erythematosus (SLE) patients, observed an inhibitory effect of ILT4 on the immunogenic capability of Dendritic cells (DC); ILT4 was shown not to have a crucial role in regulating maturation and function of DC from healthy controls but is partially involved in maturation process and immunogenic capability of DC from SLE patients
26678451 Data indicate Ig-like transcript 4 (ILT4) as a cellular receptor for complement split products (CSPs) complement component 4d (C4d).
26311318 High MicroRNA-10b promotes migration and invasion in gastric cancer.
26149216 Data show that immunoglobulin-like transcript 4 (ILT4) increases the expression of the co-inhibitory molecule B7-H3 through PI3K/AKT/mTOR signalling.
26056041 signaling involving ANGPTL2 and LILRB2 is important for lung cancer development
25948790 Findings suggest that ILT4 drives NSCLC development in part on activation of ERK signaling which in turn upregulates VEGF-C.
25551576 involvement of ILT3 and ILT4 in the modulation of immune responsiveness in multiple sclerosis by both interferon and vitamin D
25075127 PIRB and LILRB2 were expressed in mouse and human platelets, respectively.
24899623 A novel motif in the first and fourth Ig domains of LILRB2 was identified that is necessary for the receptor to be bound and activated by Angptl2.
24762057 ILT4 was found to be highly expressed in primary human ductal and lobular breast cancer cells, and its expression was significantly correlated with more IL-10 expression.
More...

AA Sequence

MTPIVTVLICLGLSLGPRTHVQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWI      1 - 70
TRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRV     71 - 140
TLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSP    141 - 210
SDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQAN    211 - 280
FTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQ    281 - 350
FHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSG    351 - 420
PSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVVLLLLLLLLLFLILRHRRQGK    421 - 490
HWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKDTQPEDGVEMDTRAAASEAPQDV    491 - 560
TYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH                                    561 - 598
//

Text Mined References (74)

PMID Year Title
27057555 2016 Analysis of the Expression and Function of Immunoglobulin-Like Transcript 4 (ILT4, LILRB2) in Dendritic Cells from Patients with Systemic Lupus Erythematosus.
26678451 2016 Ig-like transcript 4 as a cellular receptor for soluble complement fragment C4d.
26311318 2015 MicroRNA-10b promotes migration and invasion through Hoxd10 in human gastric cancer.
26149216 2015 ILT4 drives B7-H3 expression via PI3K/AKT/mTOR signalling and ILT4/B7-H3 co-expression correlates with poor prognosis in non-small cell lung cancer.
26056041 2015 ANGPTL2/LILRB2 signaling promotes the propagation of lung cancer cells.
25948790 2015 Immunoglobulin-like transcript 4 promotes tumor progression and metastasis and up-regulates VEGF-C expression via ERK signaling pathway in non-small cell lung cancer.
25714926 2015 Angiopoietin-like proteins stimulate HSPC development through interaction with notch receptor signaling.
25551576 2014 Interferon beta and vitamin D synergize to induce immunoregulatory receptors on peripheral blood monocytes of multiple sclerosis patients.
25075127 2014 Paired immunoglobulin-like receptor B regulates platelet activation.
24899623 2014 A motif in LILRB2 critical for Angptl2 binding and activation.
More...