Property Summary

NCBI Gene PubMed Count 78
PubMed Score 85.41
PubTator Score 25.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
breast carcinoma 1.200 1.1e-02
cutaneous lupus erythematosus 2.100 1.3e-03
head and neck cancer and chronic obstruc... 1.100 1.0e-03
inflammatory breast cancer 1.100 3.2e-02
interstitial cystitis 1.300 2.6e-03
invasive ductal carcinoma 1.013 1.2e-02
lung adenocarcinoma -1.851 1.9e-10
lung cancer -2.400 2.0e-03
lung carcinoma -1.900 3.6e-20
mucosa-associated lymphoid tissue lympho... 1.681 1.1e-02
non-small cell lung cancer -1.019 3.2e-11
osteosarcoma -2.506 3.3e-04
ovarian cancer -1.100 3.5e-05
ulcerative colitis 1.400 2.2e-05

Gene RIF (45)

AA Sequence

MTPIVTVLICLGLSLGPRTHVQTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWI      1 - 70
TRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRV     71 - 140
TLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSP    141 - 210
SDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQAN    211 - 280
FTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQ    281 - 350
FHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSG    351 - 420
PSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGVVIGILVAVVLLLLLLLLLFLILRHRRQGK    421 - 490
HWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKDTQPEDGVEMDTRAAASEAPQDV    491 - 560
TYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLAIH                                    561 - 598
//

Text Mined References (79)

PMID Year Title