Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.55
PubTator Score 2.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 7.08756275742227E-54
lung carcinoma 2844 1.15452855714343E-43
astrocytoma 1493 1.43048341541811E-26
oligodendroglioma 2849 6.35406513859837E-23
posterior fossa group A ependymoma 1511 8.60983775703183E-21
atypical teratoid / rhabdoid tumor 4369 1.41824167017141E-13
pilocytic astrocytoma 3086 2.18239779054033E-12
pediatric high grade glioma 2712 6.28463841399152E-10
glioblastoma 5572 6.20560383541381E-9
medulloblastoma 1524 1.66772093264148E-7
medulloblastoma, large-cell 6234 7.56090468653971E-7
non-small cell lung cancer 2798 1.01855420105495E-6
primitive neuroectodermal tumor 3031 1.64911206994919E-5
pituitary cancer 1972 3.16977200822172E-5
ovarian cancer 8492 3.38642973625864E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 3.1917367864498E-4
pancreatic cancer 2300 0.00939834862429784
subependymal giant cell astrocytoma 2287 0.00968946169516686
primary pancreatic ductal adenocarcinoma 1271 0.0103035671509782
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.010840505146456
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0323797963580163
Disease Target Count Z-score Confidence
Cockayne syndrome 54 3.558 1.8
Hemophagocytic lymphohistiocytosis 30 3.155 1.6

Expression

Synonym

Accession Q8N414 A0PJF3 B9EK58 Q5SR37 Q6PJN2
Symbols

Gene

  Ortholog (6)

Species Source
Chimp OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
26406119 DNA transposition catalyzed by PGBD5 in human cells occurs genome-wide, with precise transposon excision and preference for insertion at TTAA sites.

AA Sequence

MPDYRTRALFVQSTLGDSAGPELQLLSIVPGRDLQPSDSFTGPTRKMPPSASAVDFFQLFVPDNVLKNMV      1 - 70
VQTNMYAKKFQERFGSDGAWVEVTLTEMKAFLGYMISTSISHCESVLSIWSGGFYSNRSLALVMSQARFE     71 - 140
KILKYFHVVAFRSSQTTHGLYKVQPFLDSLQNSFDSAFRPSQTQVLHEPLIDEDPVFIATCTERELRKRK    141 - 210
KRKFSLWVRQCSSTGFIIQIYVHLKEGGGPDGLDALKNKPQLHSMVARSLCRNAAGKNYIIFTGPSITSL    211 - 280
TLFEEFEKQGIYCCGLLRARKSDCTGLPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAY    281 - 350
SPVQQGVIIKRKSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISHKPNKTWQQVFWFAISIAINNAYIL    351 - 420
YKMSDAYHVKRYSRAQFGERLVRELLGLEDASPTH                                       421 - 455
//

Text Mined References (8)

PMID Year Title
26406119 2015 Genomic DNA transposition induced by human PGBD5.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12955498 2003 Molecular evolutionary analysis of the widespread piggyBac transposon family and related "domesticated" sequences.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.