Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.55
PubTator Score 2.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
26406119 DNA transposition catalyzed by PGBD5 in human cells occurs genome-wide, with precise transposon excision and preference for insertion at TTAA sites.

AA Sequence

MPDYRTRALFVQSTLGDSAGPELQLLSIVPGRDLQPSDSFTGPTRKMPPSASAVDFFQLFVPDNVLKNMV      1 - 70
VQTNMYAKKFQERFGSDGAWVEVTLTEMKAFLGYMISTSISHCESVLSIWSGGFYSNRSLALVMSQARFE     71 - 140
KILKYFHVVAFRSSQTTHGLYKVQPFLDSLQNSFDSAFRPSQTQVLHEPLIDEDPVFIATCTERELRKRK    141 - 210
KRKFSLWVRQCSSTGFIIQIYVHLKEGGGPDGLDALKNKPQLHSMVARSLCRNAAGKNYIIFTGPSITSL    211 - 280
TLFEEFEKQGIYCCGLLRARKSDCTGLPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAY    281 - 350
SPVQQGVIIKRKSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISHKPNKTWQQVFWFAISIAINNAYIL    351 - 420
YKMSDAYHVKRYSRAQFGERLVRELLGLEDASPTH                                       421 - 455
//

Text Mined References (8)

PMID Year Title
26406119 2015 Genomic DNA transposition induced by human PGBD5.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12955498 2003 Molecular evolutionary analysis of the widespread piggyBac transposon family and related "domesticated" sequences.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.