Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.88
PubTator Score 2.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -2.900 4.4e-07
astrocytic glioma -1.600 6.7e-03
Astrocytoma, Pilocytic -3.000 1.2e-12
atypical teratoid / rhabdoid tumor -4.300 1.4e-13
ependymoma -2.000 5.3e-03
glioblastoma -3.100 1.6e-12
group 3 medulloblastoma -1.700 1.1e-03
intraductal papillary-mucinous adenoma (... -2.700 3.2e-04
intraductal papillary-mucinous carcinoma... -2.100 3.2e-02
intraductal papillary-mucinous neoplasm ... -2.600 1.1e-02
lung carcinoma 2.900 1.2e-43
medulloblastoma, large-cell -3.400 7.6e-07
non-small cell lung cancer 1.206 1.0e-06
oligodendroglioma -1.400 2.2e-02
ovarian cancer -1.500 3.4e-05
pancreatic cancer -1.100 9.4e-03
pituitary cancer 1.100 3.2e-05
primary pancreatic ductal adenocarcinoma -1.111 1.0e-02
primitive neuroectodermal tumor -3.000 1.6e-05
psoriasis 1.100 1.8e-04
subependymal giant cell astrocytoma -1.730 9.7e-03

Gene RIF (2)

AA Sequence

MAEGGGGARRRAPALLEAARARYESLHISDDVFGESGPDSGGNPFYSTSAASRSSSAASSDDEREPPGPP      1 - 70
GAAPPPPRAPDAQEPEEDEAGAGWSAALRDRPPPRFEDTGGPTRKMPPSASAVDFFQLFVPDNVLKNMVV     71 - 140
QTNMYAKKFQERFGSDGAWVEVTLTEMKAFLGYMISTSISHCESVLSIWSGGFYSNRSLALVMSQARFEK    141 - 210
ILKYFHVVAFRSSQTTHGLYKVQPFLDSLQNSFDSAFRPSQTQVLHEPLIDEDPVFIATCTERELRKRKK    211 - 280
RKFSLWVRQCSSTGFIIQIYVHLKEGGGPDGLDALKNKPQLHSMVARSLCRNAAGKNYIIFTGPSITSLT    281 - 350
LFEEFEKQGIYCCGLLRARKSDCTGLPLSMLTNPATPPARGQYQIKMKGNMSLICWYNKGHFRFLTNAYS    351 - 420
PVQQGVIIKRKSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISHKPNKTWQQVFWFAISIAINNAYILY    421 - 490
KMSDAYHVKRYSRAQFGERLVRELLGLEDASPTH                                        491 - 524
//

Text Mined References (11)

PMID Year Title