Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.43
PubTator Score 0.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (1)

AA Sequence

MPVEEFVAGWISGALGLVLGHPFDTVKVRLQTQTTYRGIVDCMVKIYRHESLLGFFKGMSFPIASIAVVN      1 - 70
SVLFGVYSNTLLVLTATSHQERRAQPPSYMHIFLAGCTGGFLQAYCLAPFDLIKVRLQNQTEPRAQPGSP     71 - 140
PPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQNPSSATVLVAGGF    141 - 210
AGIASWVAATPLDMIKSRMQMDGLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSY    211 - 280
EYLLRWWG                                                                  281 - 288
//

Text Mined References (10)

PMID Year Title