Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.43
PubTator Score 0.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Melanoma 261
Disease Target Count P-value
osteosarcoma 7933 1.58356449708033E-8
tuberculosis 1563 1.66853263560057E-6
atypical teratoid / rhabdoid tumor 4369 1.15140239210443E-4
interstitial cystitis 2299 6.42919675144964E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0032810417047782
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00643291381528985
medulloblastoma, large-cell 6234 0.00683090294760596
subependymal giant cell astrocytoma 2287 0.0158405437174241
Disease Target Count Z-score Confidence
Hartnup disease 13 4.668 2.3

Expression

Synonym

Accession Q8N413 Q6PL49 Q8IW29
Symbols

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (1)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.

AA Sequence

MPVEEFVAGWISGALGLVLGHPFDTVKVRLQTQTTYRGIVDCMVKIYRHESLLGFFKGMSFPIASIAVVN      1 - 70
SVLFGVYSNTLLVLTATSHQERRAQPPSYMHIFLAGCTGGFLQAYCLAPFDLIKVRLQNQTEPRAQPGSP     71 - 140
PPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQNPSSATVLVAGGF    141 - 210
AGIASWVAATPLDMIKSRMQMDGLRRRVYQGMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSY    211 - 280
EYLLRWWG                                                                  281 - 288
//

Text Mined References (10)

PMID Year Title
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16949250 2006 Fourteen novel human members of mitochondrial solute carrier family 25 (SLC25) widely expressed in the central nervous system.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.